Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103703
Name   oriT_pHS2953-KPC in_silico
Organism   Klebsiella pneumoniae strain HS2953
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT875328 (84305..84428 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_pHS2953-KPC
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTTTTTGAATCATTAGCTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2583 GenBank   WP_015059012
Name   traC_JG755_RS00505_pHS2953-KPC insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99393.22 Da        Isoelectric Point: 6.3465

>WP_015059012.1 MULTISPECIES: type IV secretion system protein TraC [Gammaproteobacteria]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPEMSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFKGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKKQARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(290-446)

TraG P-loop domain (P-loop_TraG)

(467-771)

TraC protein (TraC_F_IV)

(38-276)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 72357..85000

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JG755_RS00455 67594..68496 + 903 WP_002903955 L-threonate dehydrogenase -
JG755_RS00460 68508..69760 + 1253 Protein_94 3-oxo-tetronate kinase -
JG755_RS00465 69753..70184 + 432 WP_011977770 class II aldolase/adducin family protein -
JG755_RS00470 70130..70834 - 705 WP_001067855 IS6-like element IS26 family transposase -
JG755_RS00475 70896..71411 - 516 Protein_97 type-F conjugative transfer system pilin assembly protein TrbC -
JG755_RS00480 71438..71959 - 522 WP_015059014 hypothetical protein -
JG755_RS00485 72022..72330 - 309 WP_000412447 hypothetical protein -
JG755_RS00490 72357..73349 - 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
JG755_RS00495 73346..73978 - 633 WP_001203735 type-F conjugative transfer system protein TraW traW
JG755_RS00500 73975..74361 - 387 WP_015059013 type-F conjugative transfer system protein TrbI -
JG755_RS00505 74358..76985 - 2628 WP_015059012 type IV secretion system protein TraC virb4
JG755_RS00510 77145..77366 - 222 WP_001278692 conjugal transfer protein TraR -
JG755_RS00515 77501..78016 - 516 WP_199202074 type IV conjugative transfer system lipoprotein TraV traV
JG755_RS00520 78013..78264 - 252 WP_001038341 conjugal transfer protein TrbG -
JG755_RS00525 78276..78473 - 198 WP_001324648 conjugal transfer protein TrbD -
JG755_RS00530 78460..79050 - 591 WP_000002778 conjugal transfer pilus-stabilizing protein TraP -
JG755_RS00535 79040..80467 - 1428 WP_032297072 F-type conjugal transfer pilus assembly protein TraB traB
JG755_RS00540 80467..81195 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
JG755_RS00545 81182..81748 - 567 WP_000399794 type IV conjugative transfer system protein TraE traE
JG755_RS00550 81770..82081 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
JG755_RS00555 82096..82461 - 366 WP_021519752 type IV conjugative transfer system pilin TraA -
JG755_RS00560 82495..82722 - 228 WP_001254386 conjugal transfer relaxosome protein TraY -
JG755_RS00565 82816..83502 - 687 WP_015059009 PAS domain-containing protein -
JG755_RS00570 83693..84076 - 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
JG755_RS00575 84353..85000 + 648 WP_015059008 transglycosylase SLT domain-containing protein virB1
JG755_RS00580 85297..86118 - 822 WP_001234445 DUF932 domain-containing protein -
JG755_RS00585 86229..86525 - 297 WP_001272251 hypothetical protein -
JG755_RS00590 86825..87121 + 297 Protein_120 hypothetical protein -
JG755_RS00595 87440..87565 - 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
JG755_RS01010 87507..87656 - 150 Protein_122 plasmid maintenance protein Mok -
JG755_RS00600 87878..88597 - 720 WP_001276217 plasmid SOS inhibition protein A -
JG755_RS00605 88594..89028 - 435 WP_000845953 conjugation system SOS inhibitor PsiB -

Host bacterium

ID   4146 GenBank   NZ_MT875328
Plasmid name   pHS2953-KPC Incompatibility group   IncR
Plasmid size   148760 bp Coordinate of oriT [Strand]   84305..84428 [-]
Host baterium   Klebsiella pneumoniae strain HS2953

Cargo genes

Drug resistance gene   blaKPC-41, blaSHV-12, rmtB, blaTEM-1B, blaCTX-M-65
Virulence gene   -
Metal resistance gene   merR, merT, merP, merA, merD, merE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9