Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103552 |
| Name | oriT_147|P2  |
| Organism | Klebsiella pneumoniae isolate 147 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_OW970381 (17036..17086 [+], 51 nt) |
| oriT length | 51 nt |
| IRs (inverted repeats) | 6..13, 16..23 (GCAAAATT..AATTTTGC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 51 nt
>oriT_147|P2
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGGTATTTTTAGTGGTGAG
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGGTATTTTTAGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 2658 | GenBank | WP_000130000 |
| Name | Replic_Relax_LQU99_RS26440_147|P2 |
UniProt ID | R4WML4 |
| Length | 101 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 101 a.a. Molecular weight: 11477.11 Da Isoelectric Point: 7.5204
>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R4WML4 |
Host bacterium
| ID | 3995 | GenBank | NZ_OW970381 |
| Plasmid name | 147|P2 | Incompatibility group | Col440I |
| Plasmid size | 75254 bp | Coordinate of oriT [Strand] | 17036..17086 [+] |
| Host baterium | Klebsiella pneumoniae isolate 147 |
Cargo genes
| Drug resistance gene | sul1, qacE, dfrA14, qnrB1, dfrA12, aph(3')-Ia, blaCTX-M-15, mph(A) |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |