Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103521
Name   oriT_pK218-KPC in_silico
Organism   Citrobacter portucalensis strain K218
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OL988823 (50949..51037 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_pK218-KPC
GGGTGTCGGGGCGGAGCCCTGACAAGGTGGCATTTGTAATATCGTGCGTGCGCGGTATTACAAATGCACATCCTGTCCCGTTTTTTCGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2636 GenBank   WP_269467841
Name   Relaxase_N1J61_RS00310_pK218-KPC insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 102507.52 Da        Isoelectric Point: 8.3855

>WP_269467841.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Citrobacter freundii complex]
MIAVIPPKRQDGKSSFGDLVSYVSVRDEPRDDDLMEAVKASGTKPEMPHSSRFSRLVDYATKLRDESFIS
LVDVMPDGSEWVNFYGVTCFHNCTSIESAAEEMEFSARKAKFAHNKSDPVFHYILSWQSHESPRPEQIYD
SVSHTLSRLGLAGHQFVSAVHTDTDNLHVHIAVNRVHPETGYLNRLAYSQEKLSKACRELELKHGFSPDN
GCYVIAPDNRIVRRTSIERDRQSAWKRGRIQSLREYIADTAIAGLREAPVTDWSSLHQRFAKEGLFLSAD
NGELKVKDGWDSERPGVTLSAFGHAFDTEKLIRKLGEFTPPAQDIFSQVQAVGRYEPEKITVPSRPERMT
EKDTLTDYATARLRAPLIALDQDPSQRTIQSEHTLLAKSGLYLKEQHDRLVICDGYDPTRTPVRAERVWP
ALTKAVLDSYKGGWKPVPKDIFQQVPPAEQFTGGGLEATPVSDREWRKLRTGSGPQGALKREIFSDKESL
WGYAVSHCRQEIETLISSKHFSWERCHEQFAKQGLLLVREKQGLVVMDAYNREQTPVKASHVHPDLTLAR
AEPHAGSFVPVPADIFERVKPVSRYNPELAVSDRDIPGMKRDPELRRQRREARAAAREDLKARYAAWRAN
WQRPDLRGRERYQAIHDECRMRKARIRIEHRDPLVRKLYYHIVELQRMQALITLKEAMKAERAELIGQGT
WYPPSYRQWVEAEAVKGDKAAISQLRGWDYKDRRGNAVKSTTDSRCVVICEPGGTPMYSGVPGLQASLKK
NGRVQFRDPETGRHICTDYGDRVIFRNTGDYDSLKRDMVKVAPVLFSRSPTVAMAPEGNDEQFNTAFAKM
VAWHNVNHRDEAEYHIARPDVDQLRVEHEQQFTNVLNQSSYAPDAQASHQNTWEPPTPR

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(53-317)


  Protein structure



No available structure.




T4CP

ID   2445 GenBank   WP_259408534
Name   trbC_N1J61_RS00330_pK218-KPC insolico UniProt ID   _
Length   766 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 766 a.a.        Molecular weight: 87472.62 Da        Isoelectric Point: 6.9653

>WP_259408534.1 F-type conjugative transfer protein TrbC [Citrobacter portucalensis]
MNNTPVNQALMKRNAWNSPVLELMRDHLLYAGIMAGSVVAGFIWPLAIPLFLLLTIVASISFGTHRWRMP
MRMPVHLNKVDPSEDRKVRRSFFRAFPSLFQYETTQESKGKGIFYIGYKRMNDIGRELWLTLDDLTRHVM
FFASTGGGKTETIYAWMLNSFCWGRGFTFVDGKAQNDTARTCYYLARRFGREDDVEYINFMNSGMSRSEM
IQNGDKSRPQSHQWNPFCYSTEAFVAETMQSMLPTNVQGGEWQSRAIAMNKALVFGTKFYCVRENKTMSL
QLLREFMPLEKLAGLYCRAVDDQWPEEAVSPLYNYLVDVPGFDMATVRQPSAWTEEPRKQHSYLTGQFLE
TFNTFTETFGNIFAEDAGDIDIRDSIHSDRILLVLIPAMNTSQHTTSALGRMFVTQQSMILARDLGHKLE
GLDSEALEITKYKGKFPYMNYLDEVGAYYTERIAVQATQVRSLEFALVMMSQDQERIENQTSAANVATLM
QNAGTKVAGKIVSDDKTARTISNAAGQEARANMVSLQRQDGLIGTSWIDGDHINIQMENKINVQDLIKLQ
PGENYTVFQGDPVRGASFYIEPQDKTCNAPVIINRYITINPPNLKQLRKLVPRTAQRRLPAAENVSKIIG
VLTEKPSRRRKAARTEPWKIIDTFQQRLANRQEAHNLMTEYDMDHGGREENLWAEALEIIRTTTMAERTI
RYITLNKPESESTEVNAEEIQLAPDAILRNLTLPQPAYVPPARHRNEPFFSPKQTSSPQPDMEWPE

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(440-527)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 60226..96628

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N1J61_RS00320 55464..56258 + 795 WP_058687262 hypothetical protein -
N1J61_RS00325 56289..56558 - 270 WP_048227650 hypothetical protein -
N1J61_RS00330 56631..58931 - 2301 WP_259408534 F-type conjugative transfer protein TrbC -
N1J61_RS00335 59040..60170 + 1131 WP_053389034 RNA-guided endonuclease TnpB family protein -
N1J61_RS00340 60226..61425 - 1200 WP_053389035 thioredoxin fold domain-containing protein trbB
N1J61_RS00345 61478..62686 - 1209 WP_053389036 hypothetical protein trbA
N1J61_RS00350 62989..63621 - 633 WP_053069310 plasmid IncI1-type surface exclusion protein ExcA -
N1J61_RS00355 63683..65845 - 2163 WP_053389037 DotA/TraY family protein traY
N1J61_RS00360 65902..66384 - 483 WP_259408535 conjugal transfer protein TraX -
N1J61_RS00365 66440..67639 - 1200 WP_259408549 conjugal transfer protein TraW -
N1J61_RS00580 68220..71268 - 3049 Protein_73 ATP-binding protein -
N1J61_RS00375 71340..72071 - 732 WP_069325142 hypothetical protein traT
N1J61_RS00380 72255..72530 - 276 WP_259408536 DUF6750 family protein traR
N1J61_RS00385 72692..73213 - 522 WP_259408537 conjugal transfer protein TraQ traQ
N1J61_RS00390 73213..73623 - 411 WP_087879568 conjugal transfer protein TraP traP
N1J61_RS00395 73620..73982 - 363 WP_259408538 hypothetical protein traP
N1J61_RS00400 73966..75282 - 1317 WP_053389040 conjugal transfer protein TraO traO
N1J61_RS00405 75282..76265 - 984 WP_053389041 DotH/IcmK family type IV secretion protein traN
N1J61_RS00410 76276..76698 - 423 WP_259408539 DotI/IcmL family type IV secretion protein traM
N1J61_RS00415 76996..77310 - 315 Protein_82 conjugal transfer protein -
N1J61_RS00585 78610..81807 - 3198 Protein_83 LPD7 domain-containing protein -
N1J61_RS00430 81894..82181 - 288 WP_048227635 hypothetical protein traK
N1J61_RS00435 82178..83336 - 1159 Protein_85 plasmid transfer ATPase TraJ -
N1J61_RS00440 83348..84154 - 807 WP_053389046 type IV secretory system conjugative DNA transfer family protein traI
N1J61_RS00445 84151..84624 - 474 WP_053389047 DotD/TraH family lipoprotein -
N1J61_RS00450 84757..85965 - 1209 WP_053389048 conjugal transfer protein TraF -
N1J61_RS00455 86068..86904 - 837 WP_053389049 hypothetical protein traE
N1J61_RS00460 87050..87526 - 477 WP_127341066 hypothetical protein -
N1J61_RS00465 87546..88706 - 1161 WP_053389050 site-specific integrase -
N1J61_RS00470 90300..90509 - 210 WP_259408540 hypothetical protein -
N1J61_RS00475 90528..90896 - 369 WP_077223971 phage tail protein -
N1J61_RS00480 90915..92138 - 1224 WP_053389051 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
N1J61_RS00485 92104..92805 - 702 WP_259408541 prepilin peptidase -
N1J61_RS00490 92790..93272 - 483 WP_069325157 lytic transglycosylase domain-containing protein virB1
N1J61_RS00495 93357..93971 - 615 WP_052463753 type 4 pilus major pilin -
N1J61_RS00500 93985..95079 - 1095 WP_040231337 type II secretion system F family protein -
N1J61_RS00505 95072..96628 - 1557 WP_259408542 ATPase, T2SS/T4P/T4SS family virB11
N1J61_RS00510 96631..97131 - 501 WP_259408543 type IV pilus biogenesis protein PilP -
N1J61_RS00515 97115..98086 - 972 WP_259408544 type 4b pilus protein PilO2 -
N1J61_RS00520 98101..98415 - 315 WP_259408545 hypothetical protein -
N1J61_RS00525 98417..100093 - 1677 WP_048227625 PilN family type IVB pilus formation outer membrane protein -
N1J61_RS00530 100108..100203 - 96 WP_259408546 type IV pilus biogenesis protein PilM -
N1J61_RS00535 100200..100547 - 348 WP_259408547 type IV pilus biogenesis protein PilM -

Host bacterium

ID   3964 GenBank   NZ_OL988823
Plasmid name   pK218-KPC Incompatibility group   -
Plasmid size   105561 bp Coordinate of oriT [Strand]   50949..51037 [-]
Host baterium   Citrobacter portucalensis strain K218

Cargo genes

Drug resistance gene   blaKPC-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -