Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103519
Name   oriT_pK218-NR in_silico
Organism   Citrobacter portucalensis strain K218
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OL988826 (5132..5191 [-], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_pK218-NR
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATATTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2634 GenBank   WP_259408509
Name   Relaxase_N1J41_RS00010_pK218-NR insolico UniProt ID   _
Length   138 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 138 a.a.        Molecular weight: 15581.83 Da        Isoelectric Point: 9.2744

>WP_259408509.1 relaxase/mobilization nuclease domain-containing protein [Citrobacter portucalensis]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGATVLQGKPEEVRELIDASPYVKKYTSGVLSFAEADLPPGQR
EKLMASFERVLMPGLDKDQYSILWVEHADKGRLELNFLIPNTELLTGRRLQPYYDRADRPRIDAGRLS

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(57-128)


  Protein structure



No available structure.




Auxiliary protein

ID   1116 GenBank   WP_259408508
Name   WP_259408508_pK218-NR insolico UniProt ID   _
Length   102 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 102 a.a.        Molecular weight: 11338.08 Da        Isoelectric Point: 10.9762

>WP_259408508.1 MobC family plasmid mobilization relaxosome protein [Citrobacter portucalensis]
MLTMWVTEDEHRRLLERCDGRQLAAWMRQICLDEKPARSGNPSLSPALLRLAGMGNNLNQIARRVNAGGG
TGHDRVQIVAALMAIDAGLERLRHAVLERNGR

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(51-92)


  Protein structure



No available structure.




Host bacterium

ID   3962 GenBank   NZ_OL988826
Plasmid name   pK218-NR Incompatibility group   ColRNAI
Plasmid size   5400 bp Coordinate of oriT [Strand]   5132..5191 [-]
Host baterium   Citrobacter portucalensis strain K218

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -