Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103503
Name   oriT_AGR_Sprot5|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_Sprot5
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039223 (20956..21037 [+], 82 nt)
oriT length   82 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_AGR_Sprot5|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGAGCCCCGACACCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2624 GenBank   WP_241390156
Name   Relaxase_MOP33_RS00130_AGR_Sprot5|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73425.56 Da        Isoelectric Point: 7.4607

>WP_241390156.1 TraI/MobA(P) family conjugative relaxase [Serratia proteamaculans]
MIIRIPEKRRDGKSSFLQLVAYTVVRDDDKPDTPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDAGLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVTECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKEKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDLGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKRPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LSRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
SGMALAENKSGEYLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRSGHRPQQ

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)


  Protein structure



No available structure.




T4CP

ID   2433 GenBank   WP_241390158
Name   trbC_MOP33_RS00170_AGR_Sprot5|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81527.35 Da        Isoelectric Point: 8.3675

>WP_241390158.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 31835..60123

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOP33_RS00160 (Sprot5p_00016) 28044..28988 + 945 WP_241389593 hypothetical protein -
MOP33_RS00165 (Sprot5p_00017) 29124..29609 - 486 WP_241389866 phospholipase D-like domain-containing protein -
MOP33_RS00170 (Sprot5p_00018) 29620..31797 - 2178 WP_241390158 F-type conjugative transfer protein TrbC -
MOP33_RS00175 (Sprot5p_00019) 31835..32833 - 999 WP_241389596 hypothetical protein trbB
MOP33_RS00180 (Sprot5p_00020) 32845..34155 - 1311 WP_241390159 conjugal transfer protein TrbA trbA
MOP33_RS00185 (Sprot5p_00021) 34294..34836 - 543 WP_241390160 hypothetical protein -
MOP33_RS00190 (Sprot5p_00022) 34872..37166 - 2295 WP_241390161 DotA/TraY family protein traY
MOP33_RS00195 (Sprot5p_00023) 37081..37644 - 564 WP_241390162 conjugal transfer protein TraX -
MOP33_RS00200 (Sprot5p_00024) 37637..38863 - 1227 WP_010895868 conjugal transfer protein TraW traW
MOP33_RS00205 (Sprot5p_00026) 39004..42078 - 3075 WP_241390163 type IV secretory system conjugative DNA transfer family protein traU
MOP33_RS00210 (Sprot5p_00027) 42081..42686 - 606 WP_241390164 hypothetical protein traT
MOP33_RS00215 (Sprot5p_00028) 42772..43173 - 402 WP_010895871 DUF6750 family protein traR
MOP33_RS00220 (Sprot5p_00029) 43189..43719 - 531 WP_010895872 conjugal transfer protein TraQ traQ
MOP33_RS00225 (Sprot5p_00030) 43728..44471 - 744 WP_241390165 hypothetical protein traP
MOP33_RS00230 (Sprot5p_00031) 44471..45703 - 1233 WP_241390166 conjugal transfer protein TraO traO
MOP33_RS00235 (Sprot5p_00032) 45708..46715 - 1008 WP_241390167 DotH/IcmK family type IV secretion protein traN
MOP33_RS00240 (Sprot5p_00033) 46718..47392 - 675 WP_010895742 DotI/IcmL/TraM family protein traM
MOP33_RS00245 (Sprot5p_00034) 47483..47974 - 492 WP_010895743 hypothetical protein traL
MOP33_RS00250 (Sprot5p_00035) 47984..51217 - 3234 WP_241390168 LPD7 domain-containing protein -
MOP33_RS00255 (Sprot5p_00037) 51360..51626 - 267 WP_241390169 IcmT/TraK family protein traK
MOP33_RS00260 (Sprot5p_00038) 51626..52783 - 1158 WP_241389933 plasmid transfer ATPase TraJ virB11
MOP33_RS00265 (Sprot5p_00040) 52973..53761 - 789 WP_010895747 type IV secretory system conjugative DNA transfer family protein traI
MOP33_RS00270 (Sprot5p_00041) 53758..54216 - 459 WP_010895748 DotD/TraH family lipoprotein -
MOP33_RS00275 (Sprot5p_00042) 54254..55687 - 1434 WP_010895749 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOP33_RS00280 (Sprot5p_00043) 55684..56352 - 669 WP_241390170 prepilin peptidase -
MOP33_RS00285 (Sprot5p_00044) 56352..56837 - 486 WP_010895751 lytic transglycosylase domain-containing protein virB1
MOP33_RS00290 (Sprot5p_00045) 56892..57485 - 594 WP_010895752 type 4 pilus major pilin -
MOP33_RS00295 (Sprot5p_00046) 57521..58633 - 1113 WP_241389818 type II secretion system F family protein -
MOP33_RS00300 (Sprot5p_00047) 58633..60123 - 1491 WP_241390171 ATPase, T2SS/T4P/T4SS family virB11
MOP33_RS00305 (Sprot5p_00048) 60129..60713 - 585 WP_241389889 type IV pilus biogenesis protein PilP -
MOP33_RS00310 (Sprot5p_00049) 60700..62010 - 1311 WP_241389532 type 4b pilus protein PilO2 -
MOP33_RS00315 (Sprot5p_00050) 62014..63648 - 1635 WP_241390126 PilN family type IVB pilus formation outer membrane protein -
MOP33_RS00320 (Sprot5p_00051) 63673..64098 - 426 WP_010895758 type IV pilus biogenesis protein PilM -
MOP33_RS00325 (Sprot5p_00052) 64098..65111 - 1014 WP_241390127 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3946 GenBank   NZ_MT039223
Plasmid name   AGR_Sprot5|unnamed1 Incompatibility group   -
Plasmid size   120118 bp Coordinate of oriT [Strand]   20956..21037 [+]
Host baterium   Serratia proteamaculans strain AGR_Sprot5

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -