Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103502
Name   oriT_AGR_20093|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_20093
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039202 (21380..21461 [+], 82 nt)
oriT length   82 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_AGR_20093|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGAGCCCCGACACCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2623 GenBank   WP_241390156
Name   Relaxase_MOO98_RS00130_AGR_20093|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73425.56 Da        Isoelectric Point: 7.4607

>WP_241390156.1 TraI/MobA(P) family conjugative relaxase [Serratia proteamaculans]
MIIRIPEKRRDGKSSFLQLVAYTVVRDDDKPDTPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDAGLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVTECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKEKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDLGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKRPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LSRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
SGMALAENKSGEYLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRSGHRPQQ

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)


  Protein structure



No available structure.




T4CP

ID   2432 GenBank   WP_241390158
Name   trbC_MOO98_RS00170_AGR_20093|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81527.35 Da        Isoelectric Point: 8.3675

>WP_241390158.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 32259..60547

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOO98_RS00160 (20093p_00063) 28468..29412 + 945 WP_241389593 hypothetical protein -
MOO98_RS00165 (20093p_00062) 29548..30033 - 486 WP_241389866 phospholipase D-like domain-containing protein -
MOO98_RS00170 (20093p_00061) 30044..32221 - 2178 WP_241390158 F-type conjugative transfer protein TrbC -
MOO98_RS00175 (20093p_00060) 32259..33257 - 999 WP_241389596 hypothetical protein trbB
MOO98_RS00180 (20093p_00059) 33269..34579 - 1311 WP_241390159 conjugal transfer protein TrbA trbA
MOO98_RS00185 (20093p_00058) 34718..35260 - 543 WP_241390160 hypothetical protein -
MOO98_RS00190 (20093p_00057) 35296..37590 - 2295 WP_241390161 DotA/TraY family protein traY
MOO98_RS00195 (20093p_00056) 37505..38068 - 564 WP_241390162 conjugal transfer protein TraX -
MOO98_RS00200 (20093p_00055) 38061..39287 - 1227 WP_010895868 conjugal transfer protein TraW traW
MOO98_RS00205 (20093p_00053) 39428..42502 - 3075 WP_241390163 type IV secretory system conjugative DNA transfer family protein traU
MOO98_RS00210 (20093p_00052) 42505..43110 - 606 WP_241390164 hypothetical protein traT
MOO98_RS00215 (20093p_00051) 43196..43597 - 402 WP_010895871 DUF6750 family protein traR
MOO98_RS00220 (20093p_00050) 43613..44143 - 531 WP_010895872 conjugal transfer protein TraQ traQ
MOO98_RS00225 (20093p_00049) 44152..44895 - 744 WP_241390165 hypothetical protein traP
MOO98_RS00230 (20093p_00048) 44895..46127 - 1233 WP_241390166 conjugal transfer protein TraO traO
MOO98_RS00235 (20093p_00047) 46132..47139 - 1008 WP_241390167 DotH/IcmK family type IV secretion protein traN
MOO98_RS00240 (20093p_00046) 47142..47816 - 675 WP_010895742 DotI/IcmL/TraM family protein traM
MOO98_RS00245 (20093p_00045) 47907..48398 - 492 WP_010895743 hypothetical protein traL
MOO98_RS00250 (20093p_00044) 48408..51641 - 3234 WP_241390168 LPD7 domain-containing protein -
MOO98_RS00255 (20093p_00042) 51784..52050 - 267 WP_241390169 IcmT/TraK family protein traK
MOO98_RS00260 (20093p_00041) 52050..53207 - 1158 WP_241389933 plasmid transfer ATPase TraJ virB11
MOO98_RS00265 (20093p_00039) 53397..54185 - 789 WP_010895747 type IV secretory system conjugative DNA transfer family protein traI
MOO98_RS00270 (20093p_00038) 54182..54640 - 459 WP_010895748 DotD/TraH family lipoprotein -
MOO98_RS00275 (20093p_00037) 54678..56111 - 1434 WP_010895749 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOO98_RS00280 (20093p_00036) 56108..56776 - 669 WP_241390170 prepilin peptidase -
MOO98_RS00285 (20093p_00035) 56776..57261 - 486 WP_010895751 lytic transglycosylase domain-containing protein virB1
MOO98_RS00290 (20093p_00034) 57316..57909 - 594 WP_010895752 type 4 pilus major pilin -
MOO98_RS00295 (20093p_00033) 57945..59057 - 1113 WP_241389818 type II secretion system F family protein -
MOO98_RS00300 (20093p_00032) 59057..60547 - 1491 WP_241390171 ATPase, T2SS/T4P/T4SS family virB11
MOO98_RS00305 (20093p_00031) 60553..61137 - 585 WP_241389889 type IV pilus biogenesis protein PilP -
MOO98_RS00310 (20093p_00030) 61124..62434 - 1311 WP_241389532 type 4b pilus protein PilO2 -
MOO98_RS00315 (20093p_00029) 62438..64072 - 1635 WP_241390126 PilN family type IVB pilus formation outer membrane protein -
MOO98_RS00320 (20093p_00028) 64097..64522 - 426 WP_010895758 type IV pilus biogenesis protein PilM -
MOO98_RS00325 (20093p_00027) 64522..65535 - 1014 WP_241390127 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3945 GenBank   NZ_MT039202
Plasmid name   AGR_20093|unnamed1 Incompatibility group   -
Plasmid size   120992 bp Coordinate of oriT [Strand]   21380..21461 [+]
Host baterium   Serratia proteamaculans strain AGR_20093

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -