Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103494
Name   oriT_AGR_377|unnamed1 in_silico
Organism   Serratia liquefaciens strain AGR_377
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039166 (22456..22538 [+], 83 nt)
oriT length   83 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 83 nt

>oriT_AGR_377|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2616 GenBank   WP_241389863
Name   Relaxase_MOO69_RS00135_AGR_377|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73415.57 Da        Isoelectric Point: 7.4747

>WP_241389863.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIIRIPEKRRDGKSSFLQLVAYTVVRDEDKPDSPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDADLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVTECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKGKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDFGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKRPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
GGMALAENKSGEHLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRSGHRPQQ

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)


  Protein structure



No available structure.




T4CP

ID   2420 GenBank   WP_241389867
Name   trbC_MOO69_RS00170_AGR_377|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81499.33 Da        Isoelectric Point: 8.3669

>WP_241389867.1 F-type conjugative transfer protein TrbC [Serratia liquefaciens]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELAKITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 33531..61822

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOO69_RS00160 (377p_00064) 29740..30684 + 945 WP_241389593 hypothetical protein -
MOO69_RS00165 (377p_00063) 30820..31305 - 486 WP_241389866 phospholipase D-like domain-containing protein -
MOO69_RS00170 (377p_00062) 31316..33493 - 2178 WP_241389867 F-type conjugative transfer protein TrbC -
MOO69_RS00175 (377p_00061) 33531..34529 - 999 WP_241389868 hypothetical protein trbB
MOO69_RS00180 (377p_00060) 34541..35872 - 1332 WP_241389869 conjugal transfer protein TrbA trbA
MOO69_RS00185 (377p_00059) 35990..36532 - 543 WP_241389870 hypothetical protein -
MOO69_RS00190 (377p_00058) 36568..38841 - 2274 WP_241389871 DotA/TraY family protein traY
MOO69_RS00195 (377p_00057) 38777..39340 - 564 WP_241389872 conjugal transfer protein TraX -
MOO69_RS00200 (377p_00056) 39333..40559 - 1227 WP_241389873 conjugal transfer protein TraW traW
MOO69_RS00205 (377p_00054) 40700..43774 - 3075 WP_241389874 type IV secretory system conjugative DNA transfer family protein traU
MOO69_RS00210 (377p_00053) 43777..44382 - 606 WP_241389875 hypothetical protein traT
MOO69_RS00215 (377p_00052) 44469..44870 - 402 WP_241389876 DUF6750 family protein traR
MOO69_RS00220 (377p_00051) 44886..45416 - 531 WP_241389877 conjugal transfer protein TraQ traQ
MOO69_RS00225 (377p_00050) 45425..46168 - 744 WP_241389878 hypothetical protein traP
MOO69_RS00230 (377p_00049) 46168..47400 - 1233 WP_241389879 conjugal transfer protein TraO traO
MOO69_RS00235 (377p_00048) 47404..48411 - 1008 WP_010895741 DotH/IcmK family type IV secretion protein traN
MOO69_RS00240 (377p_00047) 48414..49088 - 675 WP_010895742 DotI/IcmL/TraM family protein traM
MOO69_RS00245 (377p_00046) 49179..49670 - 492 WP_241389880 hypothetical protein traL
MOO69_RS00250 (377p_00045) 49680..52916 - 3237 WP_241389881 LPD7 domain-containing protein -
MOO69_RS00255 (377p_00043) 53059..53325 - 267 WP_241389612 IcmT/TraK family protein traK
MOO69_RS00260 (377p_00042) 53325..54482 - 1158 WP_241389613 plasmid transfer ATPase TraJ virB11
MOO69_RS00265 (377p_00040) 54672..55460 - 789 WP_241389822 type IV secretory system conjugative DNA transfer family protein traI
MOO69_RS00270 (377p_00039) 55457..55915 - 459 WP_241389823 DotD/TraH family lipoprotein -
MOO69_RS00275 (377p_00038) 55953..57386 - 1434 WP_241389824 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOO69_RS00280 (377p_00037) 57383..58051 - 669 WP_241389825 prepilin peptidase -
MOO69_RS00285 (377p_00036) 58051..58536 - 486 WP_241389826 lytic transglycosylase domain-containing protein virB1
MOO69_RS00290 (377p_00035) 58591..59184 - 594 WP_010895752 type 4 pilus major pilin -
MOO69_RS00295 (377p_00034) 59220..60332 - 1113 WP_241389827 type II secretion system F family protein -
MOO69_RS00300 (377p_00033) 60332..61822 - 1491 WP_241389828 ATPase, T2SS/T4P/T4SS family virB11
MOO69_RS00305 (377p_00032) 61828..62412 - 585 WP_241389829 type IV pilus biogenesis protein PilP -
MOO69_RS00310 (377p_00031) 62399..63709 - 1311 WP_241389830 type 4b pilus protein PilO2 -
MOO69_RS00315 (377p_00030) 63713..65347 - 1635 WP_241389831 PilN family type IVB pilus formation outer membrane protein -
MOO69_RS00320 (377p_00029) 65372..65797 - 426 WP_010895758 type IV pilus biogenesis protein PilM -
MOO69_RS00325 (377p_00028) 65797..66741 - 945 WP_241389832 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3937 GenBank   NZ_MT039166
Plasmid name   AGR_377|unnamed1 Incompatibility group   -
Plasmid size   103562 bp Coordinate of oriT [Strand]   22456..22538 [+]
Host baterium   Serratia liquefaciens strain AGR_377

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -