Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103491
Name   oriT_AGR_376|unnamed1 in_silico
Organism   Serratia liquefaciens strain AGR_376
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039165 (22156..22238 [+], 83 nt)
oriT length   83 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 83 nt

>oriT_AGR_376|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2613 GenBank   WP_241389863
Name   Relaxase_MOO74_RS00145_AGR_376|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73415.57 Da        Isoelectric Point: 7.4747

>WP_241389863.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIIRIPEKRRDGKSSFLQLVAYTVVRDEDKPDSPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDADLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVTECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKGKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDFGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKRPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
GGMALAENKSGEHLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRSGHRPQQ

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)


  Protein structure



No available structure.




T4CP

ID   2415 GenBank   WP_241389867
Name   trbC_MOO74_RS00180_AGR_376|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81499.33 Da        Isoelectric Point: 8.3669

>WP_241389867.1 F-type conjugative transfer protein TrbC [Serratia liquefaciens]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELAKITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 33044..61335

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOO74_RS00170 (376p_00068) 29253..30197 + 945 WP_241389593 hypothetical protein -
MOO74_RS00175 (376p_00067) 30333..30818 - 486 WP_241389866 phospholipase D-like domain-containing protein -
MOO74_RS00180 (376p_00066) 30829..33006 - 2178 WP_241389867 F-type conjugative transfer protein TrbC -
MOO74_RS00185 (376p_00065) 33044..34042 - 999 WP_241389868 hypothetical protein trbB
MOO74_RS00190 (376p_00064) 34054..35385 - 1332 WP_241389869 conjugal transfer protein TrbA trbA
MOO74_RS00195 (376p_00063) 35503..36045 - 543 WP_241389870 hypothetical protein -
MOO74_RS00200 (376p_00062) 36081..38354 - 2274 WP_241389871 DotA/TraY family protein traY
MOO74_RS00205 (376p_00061) 38290..38853 - 564 WP_241389872 conjugal transfer protein TraX -
MOO74_RS00210 (376p_00060) 38846..40072 - 1227 WP_241389873 conjugal transfer protein TraW traW
MOO74_RS00215 (376p_00058) 40213..43287 - 3075 WP_241389874 type IV secretory system conjugative DNA transfer family protein traU
MOO74_RS00220 (376p_00057) 43290..43895 - 606 WP_241389875 hypothetical protein traT
MOO74_RS00225 (376p_00056) 43982..44383 - 402 WP_241389876 DUF6750 family protein traR
MOO74_RS00230 (376p_00055) 44399..44929 - 531 WP_241389877 conjugal transfer protein TraQ traQ
MOO74_RS00235 (376p_00054) 44938..45681 - 744 WP_241389878 hypothetical protein traP
MOO74_RS00240 (376p_00053) 45681..46913 - 1233 WP_241389879 conjugal transfer protein TraO traO
MOO74_RS00245 (376p_00052) 46917..47924 - 1008 WP_010895741 DotH/IcmK family type IV secretion protein traN
MOO74_RS00250 (376p_00051) 47927..48601 - 675 WP_010895742 DotI/IcmL/TraM family protein traM
MOO74_RS00255 (376p_00050) 48692..49183 - 492 WP_241389880 hypothetical protein traL
MOO74_RS00260 (376p_00049) 49193..52429 - 3237 WP_241389881 LPD7 domain-containing protein -
MOO74_RS00265 (376p_00047) 52572..52838 - 267 WP_241389612 IcmT/TraK family protein traK
MOO74_RS00270 (376p_00046) 52838..53995 - 1158 WP_241389613 plasmid transfer ATPase TraJ virB11
MOO74_RS00275 (376p_00044) 54185..54973 - 789 WP_241389822 type IV secretory system conjugative DNA transfer family protein traI
MOO74_RS00280 (376p_00043) 54970..55428 - 459 WP_241389823 DotD/TraH family lipoprotein -
MOO74_RS00285 (376p_00042) 55466..56899 - 1434 WP_241389824 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOO74_RS00290 (376p_00041) 56896..57564 - 669 WP_241389825 prepilin peptidase -
MOO74_RS00295 (376p_00040) 57564..58049 - 486 WP_241389826 lytic transglycosylase domain-containing protein virB1
MOO74_RS00300 (376p_00039) 58104..58697 - 594 WP_010895752 type 4 pilus major pilin -
MOO74_RS00305 (376p_00038) 58733..59848 - 1116 WP_241389936 type II secretion system F family protein -
MOO74_RS00310 (376p_00037) 59845..61335 - 1491 WP_241389828 ATPase, T2SS/T4P/T4SS family virB11
MOO74_RS00315 (376p_00036) 61341..61925 - 585 WP_241389829 type IV pilus biogenesis protein PilP -
MOO74_RS00320 (376p_00035) 61912..63222 - 1311 WP_241389830 type 4b pilus protein PilO2 -
MOO74_RS00325 (376p_00034) 63226..64860 - 1635 WP_241389831 PilN family type IVB pilus formation outer membrane protein -
MOO74_RS00330 (376p_00033) 64885..65310 - 426 WP_010895758 type IV pilus biogenesis protein PilM -
MOO74_RS00335 (376p_00032) 65310..66254 - 945 WP_241389832 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3934 GenBank   NZ_MT039165
Plasmid name   AGR_376|unnamed1 Incompatibility group   -
Plasmid size   105896 bp Coordinate of oriT [Strand]   22156..22238 [+]
Host baterium   Serratia liquefaciens strain AGR_376

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -