Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103485
Name   oriT_AGR_220|unnamed1 in_silico
Organism   Serratia entomophila strain AGR_220
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039147 (83415..83497 [+], 83 nt)
oriT length   83 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 83 nt

>oriT_AGR_220|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2607 GenBank   WP_241392172
Name   Relaxase_MOO63_RS00450_AGR_220|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73366.68 Da        Isoelectric Point: 7.6690

>WP_241392172.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIIRIPEKRRDGKSSFLQLVAYTVVRDDDKPDTPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDAGLQQI
MHADPHGHTQVMFDGVMCETNCFNITTASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNDQGEIVRSKREKSLTPSGAKALEYYADVESLHTYAVTECGFKIDEAMADPNLTWKDVHRIMVNAGLAL
KPKGKGLAIYSIDNPELPPVKASSVHPDLTLGCLEKDLGLFQPLENVGTYTKDHTTTATDAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKHTWKRPRLDASVVKRRYQNESKRFAWQKARARVAVGDP
LLRKLTYHIIEVERMKAMAALRLAVKEERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTASISTNSIVCAVADDTPAFALEGYGTLVTRDGTVQYVRDGRIELQDKGERIEVGDHRVNEGEHIA
GGMALAENKSGEHLKFEGEPVFVQQACSMVRWFNAGGEAPLPLSDPQQRIMAGYDASSQAISTGEGQHKP
SADEHPDVGQNKPRSGYRPQQ

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(523-590)

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-318)


  Protein structure



No available structure.




T4CP

ID   2407 GenBank   WP_241392175
Name   trbC_MOO63_RS00465_AGR_220|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81653.39 Da        Isoelectric Point: 8.3675

>WP_241392175.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSRPVEVDPRRVRRPLGYTFINDALLSPIGVQLSLLAGLIVGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIKDDDKMTSSLPMRINRFIDVETPTEAELFTLNPSLKRKLPPTAQEIDG
ILQRLDQAMNTTTSAGMMDPVLKRVAAVALDLDNRADVSYSPTQRGVLLFEAAREALHQNKRNWRQLPSP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 88965..118242

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOO63_RS00455 (220p1_00097) 85870..86193 - 324 WP_241392173 hypothetical protein -
MOO63_RS00460 (220p1_00098) 86203..86739 - 537 WP_241392174 phospholipase D family protein -
MOO63_RS00465 (220p1_00099) 86750..88927 - 2178 WP_241392175 F-type conjugative transfer protein TrbC -
MOO63_RS00470 (220p1_00100) 88965..89978 - 1014 WP_241392176 hypothetical protein trbB
MOO63_RS00475 (220p1_00101) 89992..91251 - 1260 WP_241392177 conjugal transfer protein TrbA trbA
MOO63_RS00480 (220p1_00102) 91444..92022 - 579 WP_241392178 hypothetical protein -
MOO63_RS00485 (220p1_00103) 92019..94163 - 2145 WP_241392179 DotA/TraY family protein traY
MOO63_RS00490 (220p1_00104) 94227..94790 - 564 WP_241392180 conjugal transfer protein TraX -
MOO63_RS00495 (220p1_00105) 94783..96009 - 1227 WP_241392181 conjugal transfer protein TraW traW
MOO63_RS00500 (220p1_00107) 96150..99224 - 3075 WP_241392182 type IV secretory system conjugative DNA transfer family protein traU
MOO63_RS00505 (220p1_00108) 99227..99832 - 606 WP_241392183 hypothetical protein traT
MOO63_RS00510 (220p1_00109) 99915..100316 - 402 WP_241392184 DUF6750 family protein traR
MOO63_RS00515 (220p1_00110) 100332..100862 - 531 WP_241392185 conjugal transfer protein TraQ traQ
MOO63_RS00520 (220p1_00111) 100871..101614 - 744 WP_241392186 hypothetical protein traP
MOO63_RS00525 (220p1_00112) 101614..102846 - 1233 WP_241392187 conjugal transfer protein TraO traO
MOO63_RS00530 (220p1_00113) 102851..103858 - 1008 WP_241392188 DotH/IcmK family type IV secretion protein traN
MOO63_RS00535 (220p1_00114) 103861..104535 - 675 WP_241392189 DotI/IcmL/TraM family protein traM
MOO63_RS00540 (220p1_00115) 104628..105119 - 492 WP_241392190 hypothetical protein traL
MOO63_RS00545 (220p1_00116) 105129..108362 - 3234 WP_241392191 LPD7 domain-containing protein -
MOO63_RS00550 (220p1_00118) 108505..108771 - 267 WP_241392192 IcmT/TraK family protein traK
MOO63_RS00555 (220p1_00119) 108771..109928 - 1158 WP_241392193 plasmid transfer ATPase TraJ virB11
MOO63_RS00560 (220p1_00120) 109959..110747 - 789 WP_241392194 type IV secretory system conjugative DNA transfer family protein traI
MOO63_RS00565 (220p1_00121) 110744..111208 - 465 WP_241392195 DotD/TraH family lipoprotein -
MOO63_RS00570 (220p1_00122) 111302..112378 - 1077 WP_241392196 acyltransferase -
MOO63_RS00575 (220p1_00123) 112458..113810 - 1353 WP_241392197 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOO63_RS00580 (220p1_00124) 113807..114475 - 669 WP_241392198 prepilin peptidase -
MOO63_RS00585 (220p1_00125) 114475..114960 - 486 WP_241392199 lytic transglycosylase domain-containing protein virB1
MOO63_RS00590 (220p1_00126) 115015..115605 - 591 WP_241392200 type 4 pilus major pilin -
MOO63_RS00595 (220p1_00127) 115640..116755 - 1116 WP_241392201 type II secretion system F family protein -
MOO63_RS00600 (220p1_00128) 116752..118242 - 1491 WP_241392202 ATPase, T2SS/T4P/T4SS family virB11
MOO63_RS00605 (220p1_00129) 118248..118832 - 585 WP_241392203 type IV pilus biogenesis protein PilP -
MOO63_RS00610 (220p1_00130) 118819..120123 - 1305 WP_241392204 type 4b pilus protein PilO2 -
MOO63_RS00615 (220p1_00131) 120127..121761 - 1635 WP_241392205 PilN family type IVB pilus formation outer membrane protein -
MOO63_RS00620 (220p1_00132) 121784..122209 - 426 WP_241392206 type IV pilus biogenesis protein PilM -
MOO63_RS00625 (220p1_00133) 122209..123147 - 939 WP_241392207 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3928 GenBank   NZ_MT039147
Plasmid name   AGR_220|unnamed1 Incompatibility group   -
Plasmid size   145178 bp Coordinate of oriT [Strand]   83415..83497 [+]
Host baterium   Serratia entomophila strain AGR_220

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -