Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103477
Name   oriT_AGR_M|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_M
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039212 (22696..22778 [+], 83 nt)
oriT length   83 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 83 nt

>oriT_AGR_M|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAAGGCTGGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2600 GenBank   WP_241390305
Name   Relaxase_MOP41_RS00145_AGR_M|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73396.69 Da        Isoelectric Point: 7.3282

>WP_241390305.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIIRIPEKRRDGKSSFLQLVAYTVVRDEDKPDSPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDVDLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKVADDCFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVSECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKGKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDLGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKCPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
GGMALAENKSGEHLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRPGHRPQQ

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)


  Protein structure



No available structure.




T4CP

ID   2400 GenBank   WP_241390158
Name   trbC_MOP41_RS00185_AGR_M|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81527.35 Da        Isoelectric Point: 8.3675

>WP_241390158.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 33574..61853

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOP41_RS00175 (Mp_00071) 29783..30727 + 945 WP_241389593 hypothetical protein -
MOP41_RS00180 (Mp_00070) 30863..31348 - 486 WP_241389866 phospholipase D-like domain-containing protein -
MOP41_RS00185 (Mp_00069) 31359..33536 - 2178 WP_241390158 F-type conjugative transfer protein TrbC -
MOP41_RS00190 (Mp_00068) 33574..34572 - 999 WP_241390308 hypothetical protein trbB
MOP41_RS00195 (Mp_00067) 34585..35895 - 1311 WP_241390430 conjugal transfer protein TrbA trbA
MOP41_RS00200 (Mp_00066) 36024..36602 - 579 WP_241389923 hypothetical protein -
MOP41_RS00205 (Mp_00065) 36599..38893 - 2295 WP_261097221 DotA/TraY family protein -
MOP41_RS00210 (Mp_00064) 38808..39371 - 564 WP_241390311 conjugal transfer protein TraX -
MOP41_RS00215 (Mp_00063) 39364..40590 - 1227 WP_241390312 conjugal transfer protein TraW traW
MOP41_RS00220 (Mp_00061) 40731..43805 - 3075 WP_241390313 type IV secretory system conjugative DNA transfer family protein traU
MOP41_RS00225 (Mp_00060) 43808..44413 - 606 WP_241389875 hypothetical protein traT
MOP41_RS00230 (Mp_00059) 44500..44901 - 402 WP_241389604 DUF6750 family protein traR
MOP41_RS00235 (Mp_00058) 44917..45447 - 531 WP_241389877 conjugal transfer protein TraQ traQ
MOP41_RS00240 (Mp_00057) 45456..46199 - 744 WP_241390314 hypothetical protein traP
MOP41_RS00245 (Mp_00056) 46199..47431 - 1233 WP_241389929 conjugal transfer protein TraO traO
MOP41_RS00250 (Mp_00055) 47435..48442 - 1008 WP_241390316 DotH/IcmK family type IV secretion protein traN
MOP41_RS00255 (Mp_00054) 48445..49119 - 675 WP_241390317 DotI/IcmL/TraM family protein traM
MOP41_RS00260 (Mp_00053) 49210..49701 - 492 WP_010895743 hypothetical protein traL
MOP41_RS00265 (Mp_00052) 49711..52947 - 3237 WP_241390318 LPD7 domain-containing protein -
MOP41_RS00270 (Mp_00050) 53090..53356 - 267 WP_241390319 IcmT/TraK family protein traK
MOP41_RS00275 (Mp_00049) 53356..54513 - 1158 WP_241389933 plasmid transfer ATPase TraJ virB11
MOP41_RS00280 (Mp_00047) 54703..55491 - 789 WP_010895747 type IV secretory system conjugative DNA transfer family protein traI
MOP41_RS00285 (Mp_00046) 55488..55946 - 459 WP_010895748 DotD/TraH family lipoprotein -
MOP41_RS00290 (Mp_00045) 55984..57417 - 1434 WP_010895749 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOP41_RS00295 (Mp_00044) 57414..58082 - 669 WP_241390170 prepilin peptidase -
MOP41_RS00300 (Mp_00043) 58082..58567 - 486 WP_010895751 lytic transglycosylase domain-containing protein virB1
MOP41_RS00305 (Mp_00042) 58622..59215 - 594 WP_010895752 type 4 pilus major pilin -
MOP41_RS00310 (Mp_00041) 59251..60363 - 1113 WP_241389818 type II secretion system F family protein -
MOP41_RS00315 (Mp_00040) 60363..61853 - 1491 WP_241389888 ATPase, T2SS/T4P/T4SS family virB11
MOP41_RS00320 (Mp_00039) 61859..62443 - 585 WP_241389889 type IV pilus biogenesis protein PilP -
MOP41_RS00325 (Mp_00038) 62430..63740 - 1311 WP_241390279 type 4b pilus protein PilO2 -
MOP41_RS00330 (Mp_00037) 63744..65378 - 1635 WP_241389891 PilN family type IVB pilus formation outer membrane protein -
MOP41_RS00335 (Mp_00036) 65400..65825 - 426 WP_241389892 type IV pilus biogenesis protein PilM -
MOP41_RS00340 (Mp_00035) 65825..66838 - 1014 WP_241390280 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3920 GenBank   NZ_MT039212
Plasmid name   AGR_M|unnamed1 Incompatibility group   -
Plasmid size   145501 bp Coordinate of oriT [Strand]   22696..22778 [+]
Host baterium   Serratia proteamaculans strain AGR_M

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -