Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103475
Name   oriT_AGR_D|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_D
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039205 (22600..22682 [+], 83 nt)
oriT length   83 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 83 nt

>oriT_AGR_D|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAAGGCTGGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2598 GenBank   WP_241390305
Name   Relaxase_MOP43_RS00145_AGR_D|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73396.69 Da        Isoelectric Point: 7.3282

>WP_241390305.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIIRIPEKRRDGKSSFLQLVAYTVVRDEDKPDSPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDVDLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKVADDCFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVSECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKGKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDLGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKCPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
GGMALAENKSGEHLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRPGHRPQQ

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)


  Protein structure



No available structure.




T4CP

ID   2398 GenBank   WP_241389595
Name   trbC_MOP43_RS00195_AGR_D|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81541.37 Da        Isoelectric Point: 8.3675

>WP_241389595.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDILHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 33389..61695

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOP43_RS00180 (Dp_00073) 29641..30585 + 945 WP_241389593 hypothetical protein -
MOP43_RS00185 (Dp_00072) 30721..30969 - 249 WP_336286899 helix-turn-helix domain-containing protein -
MOP43_RS00190 (Dp_00071) 30969..31151 - 183 WP_241391732 hypothetical protein -
MOP43_RS00195 (Dp_00070) 31174..33351 - 2178 WP_241389595 F-type conjugative transfer protein TrbC -
MOP43_RS00200 (Dp_00069) 33389..34387 - 999 WP_241389596 hypothetical protein trbB
MOP43_RS00205 (Dp_00068) 34399..35709 - 1311 WP_241389597 conjugal transfer protein TrbA trbA
MOP43_RS00210 (Dp_00067) 35848..36429 - 582 WP_241390917 hypothetical protein -
MOP43_RS00215 (Dp_00066) 36426..38570 - 2145 WP_241389599 DotA/TraY family protein traY
MOP43_RS00220 (Dp_00065) 38635..39207 - 573 WP_241390359 conjugal transfer protein TraX -
MOP43_RS00225 (Dp_00064) 39200..40426 - 1227 WP_241389601 conjugal transfer protein TraW traW
MOP43_RS00230 (Dp_00062) 40567..43641 - 3075 WP_241389602 type IV secretory system conjugative DNA transfer family protein traU
MOP43_RS00235 (Dp_00061) 43644..44249 - 606 WP_241389603 hypothetical protein traT
MOP43_RS00240 (Dp_00060) 44336..44737 - 402 WP_241389604 DUF6750 family protein traR
MOP43_RS00245 (Dp_00059) 44753..45283 - 531 WP_241389605 conjugal transfer protein TraQ traQ
MOP43_RS00250 (Dp_00058) 45292..46041 - 750 WP_241389606 hypothetical protein traP
MOP43_RS00255 (Dp_00057) 46041..47273 - 1233 WP_241389607 conjugal transfer protein TraO traO
MOP43_RS00260 (Dp_00056) 47277..48284 - 1008 WP_241391733 DotH/IcmK family type IV secretion protein traN
MOP43_RS00265 (Dp_00055) 48287..48961 - 675 WP_010895742 DotI/IcmL/TraM family protein traM
MOP43_RS00270 (Dp_00054) 49052..49543 - 492 WP_241389610 hypothetical protein traL
MOP43_RS00275 (Dp_00053) 49553..52789 - 3237 WP_241391734 LPD7 domain-containing protein -
MOP43_RS00280 (Dp_00051) 52932..53198 - 267 WP_241389612 IcmT/TraK family protein traK
MOP43_RS00285 (Dp_00050) 53198..54355 - 1158 WP_241389613 plasmid transfer ATPase TraJ virB11
MOP43_RS00290 (Dp_00048) 54545..55333 - 789 WP_010895747 type IV secretory system conjugative DNA transfer family protein traI
MOP43_RS00295 (Dp_00047) 55330..55788 - 459 WP_241391735 DotD/TraH family lipoprotein -
MOP43_RS00300 (Dp_00046) 55826..57259 - 1434 WP_241389615 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOP43_RS00305 (Dp_00045) 57256..57924 - 669 WP_241389616 prepilin peptidase -
MOP43_RS00310 (Dp_00044) 57924..58409 - 486 WP_241389617 lytic transglycosylase domain-containing protein virB1
MOP43_RS00315 (Dp_00043) 58464..59057 - 594 WP_010895752 type 4 pilus major pilin -
MOP43_RS00320 (Dp_00042) 59093..60145 - 1053 WP_241390342 type II secretion system F family protein -
MOP43_RS00325 (Dp_00041) 60205..61695 - 1491 WP_010895754 ATPase, T2SS/T4P/T4SS family virB11
MOP43_RS00330 (Dp_00040) 61701..62285 - 585 WP_241390343 type IV pilus biogenesis protein PilP -
MOP43_RS00335 (Dp_00039) 62272..63582 - 1311 WP_241389532 type 4b pilus protein PilO2 -
MOP43_RS00340 (Dp_00038) 63586..65220 - 1635 WP_241389533 PilN family type IVB pilus formation outer membrane protein -
MOP43_RS00345 (Dp_00037) 65245..65670 - 426 WP_010895758 type IV pilus biogenesis protein PilM -
MOP43_RS00350 (Dp_00036) 65670..66683 - 1014 WP_241389534 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3918 GenBank   NZ_MT039205
Plasmid name   AGR_D|unnamed1 Incompatibility group   -
Plasmid size   143583 bp Coordinate of oriT [Strand]   22600..22682 [+]
Host baterium   Serratia proteamaculans strain AGR_D

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -