Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103471
Name   oriT_AGR_RM5|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_RM5
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039218 (22271..22353 [+], 83 nt)
oriT length   83 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 83 nt

>oriT_AGR_RM5|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2594 GenBank   WP_241391287
Name   Relaxase_MOP34_RS00140_AGR_RM5|unnamed1 insolico UniProt ID   _
Length   597 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 597 a.a.        Molecular weight: 66875.16 Da        Isoelectric Point: 7.1901

>WP_241391287.1 TraI/MobA(P) family conjugative relaxase [Serratia proteamaculans]
MLITSAGNGDADLQQIMHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWP
ETDNPSTEHIFDSVRHSLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAAR
ELELKYNWTPTNGFFAVNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVTECGFKIDEAMADPNL
AWKDIHCILVNAGLALKPKGKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDFGQFQLLENAGTYTKDH
TTTAADAIVHEFRYEPTLHARDLTARLERRLARADARADLKARYQAYKNAWKRPKLDAGAVKRRYQNESK
RFAWQKARARVAIGDPLLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSH
DQAAIAQLRAFAYRMKRTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGE
RIDVGDHRVNEGEHIAGGMALAENKSGEHLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGY
ESTYQSASTGEGQRKPSAVEQPEVEQNKPRSGHRPQQ

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(35-266)

Large polyvalent protein-associated domain 7 (LPD7)

(464-535)


  Protein structure



No available structure.




T4CP

ID   2394 GenBank   WP_241390383
Name   t4cp1_MOP34_RS00180_AGR_RM5|unnamed1 insolico UniProt ID   _
Length   440 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 440 a.a.        Molecular weight: 49869.16 Da        Isoelectric Point: 9.3594

>WP_241390383.1 type IV secretory system conjugative DNA transfer family protein [Serratia proteamaculans]
MSRPVEVDPRRVRRPLGYTFINDALLSPIGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMSAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQSWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFP

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 32251..60530

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOP34_RS00165 (RM5p1_00046) 27264..27863 - 600 WP_241390381 hypothetical protein -
MOP34_RS00170 (RM5p1_00048) 29359..30303 + 945 WP_241390382 hypothetical protein -
MOP34_RS00175 30439..30912 - 474 WP_241390391 helix-turn-helix domain-containing protein -
MOP34_RS00180 (RM5p1_00050) 30891..32213 - 1323 WP_241390383 type IV secretory system conjugative DNA transfer family protein -
MOP34_RS00185 (RM5p1_00051) 32251..33249 - 999 WP_241390384 hypothetical protein trbB
MOP34_RS00190 (RM5p1_00052) 33262..34572 - 1311 WP_241390385 conjugal transfer protein TrbA trbA
MOP34_RS00195 (RM5p1_00053) 34704..35282 - 579 WP_241389923 hypothetical protein -
MOP34_RS00200 (RM5p1_00054) 35279..37552 - 2274 WP_336251228 DotA/TraY family protein -
MOP34_RS00205 (RM5p1_00055) 37488..38051 - 564 WP_241389872 conjugal transfer protein TraX -
MOP34_RS00210 (RM5p1_00056) 38044..39270 - 1227 WP_241390386 conjugal transfer protein TraW traW
MOP34_RS00215 (RM5p1_00058) 39411..42485 - 3075 WP_241389874 type IV secretory system conjugative DNA transfer family protein traU
MOP34_RS00220 (RM5p1_00059) 42488..43093 - 606 WP_241389875 hypothetical protein traT
MOP34_RS00225 (RM5p1_00060) 43180..43581 - 402 WP_241389876 DUF6750 family protein traR
MOP34_RS00230 (RM5p1_00061) 43597..44127 - 531 WP_241389877 conjugal transfer protein TraQ traQ
MOP34_RS00235 (RM5p1_00062) 44136..44879 - 744 WP_241390387 hypothetical protein traP
MOP34_RS00240 (RM5p1_00063) 44879..46111 - 1233 WP_241390388 conjugal transfer protein TraO traO
MOP34_RS00245 (RM5p1_00064) 46115..47122 - 1008 WP_241390389 DotH/IcmK family type IV secretion protein traN
MOP34_RS00250 (RM5p1_00065) 47125..47811 - 687 WP_241389609 DotI/IcmL/TraM family protein traM
MOP34_RS00255 (RM5p1_00066) 47890..48381 - 492 WP_010895743 hypothetical protein traL
MOP34_RS00260 (RM5p1_00067) 48391..51627 - 3237 WP_241390390 LPD7 domain-containing protein -
MOP34_RS00265 (RM5p1_00069) 51770..52036 - 267 WP_241389612 IcmT/TraK family protein traK
MOP34_RS00270 (RM5p1_00070) 52036..53193 - 1158 WP_241389613 plasmid transfer ATPase TraJ virB11
MOP34_RS00275 (RM5p1_00072) 53355..54170 - 816 WP_241391277 type IV secretory system conjugative DNA transfer family protein traI
MOP34_RS00280 (RM5p1_00073) 54167..54625 - 459 WP_241389823 DotD/TraH family lipoprotein -
MOP34_RS00285 (RM5p1_00074) 54663..56096 - 1434 WP_241390362 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOP34_RS00290 (RM5p1_00075) 56089..56760 - 672 WP_241391278 prepilin peptidase -
MOP34_RS00295 (RM5p1_00076) 56760..57245 - 486 WP_010895751 lytic transglycosylase domain-containing protein virB1
MOP34_RS00300 (RM5p1_00077) 57300..57560 - 261 WP_336251226 type 4 pilus major pilin -
MOP34_RS00510 (RM5p1_00078) 57494..57892 - 399 WP_336251227 hypothetical protein -
MOP34_RS00305 (RM5p1_00079) 57928..59040 - 1113 WP_241389818 type II secretion system F family protein -
MOP34_RS00310 (RM5p1_00080) 59040..60530 - 1491 WP_241390365 ATPase, T2SS/T4P/T4SS family virB11
MOP34_RS00315 (RM5p1_00081) 60536..61120 - 585 WP_241389889 type IV pilus biogenesis protein PilP -
MOP34_RS00320 (RM5p1_00082) 61107..62177 - 1071 WP_241391279 type 4b pilus protein PilO2 -
MOP34_RS00325 (RM5p1_00083) 62168..62416 - 249 WP_241391280 hypothetical protein -
MOP34_RS00330 (RM5p1_00084) 62420..64054 - 1635 WP_241390367 PilN family type IVB pilus formation outer membrane protein -
MOP34_RS00335 (RM5p1_00085) 64076..64501 - 426 WP_241389892 type IV pilus biogenesis protein PilM -
MOP34_RS00340 (RM5p1_00086) 64501..65514 - 1014 WP_241390280 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3914 GenBank   NZ_MT039218
Plasmid name   AGR_RM5|unnamed1 Incompatibility group   -
Plasmid size   105800 bp Coordinate of oriT [Strand]   22271..22353 [+]
Host baterium   Serratia proteamaculans strain AGR_RM5

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -