Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103469
Name   oriT_AGR_12d|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_12d
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039175 (22696..22778 [+], 83 nt)
oriT length   83 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 83 nt

>oriT_AGR_12d|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAAGGCTGGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2592 GenBank   WP_241390305
Name   Relaxase_MOO97_RS00150_AGR_12d|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73396.69 Da        Isoelectric Point: 7.3282

>WP_241390305.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIIRIPEKRRDGKSSFLQLVAYTVVRDEDKPDSPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDVDLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKVADDCFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVSECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKGKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDLGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKCPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
GGMALAENKSGEHLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRPGHRPQQ

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)


  Protein structure



No available structure.




T4CP

ID   2392 GenBank   WP_241390158
Name   trbC_MOO97_RS00190_AGR_12d|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81527.35 Da        Isoelectric Point: 8.3675

>WP_241390158.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 33575..61854

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOO97_RS00180 (12dp_00071) 29784..30728 + 945 WP_241389593 hypothetical protein -
MOO97_RS00185 (12dp_00070) 30864..31349 - 486 WP_241389866 phospholipase D-like domain-containing protein -
MOO97_RS00190 (12dp_00069) 31360..33537 - 2178 WP_241390158 F-type conjugative transfer protein TrbC -
MOO97_RS00195 (12dp_00068) 33575..34573 - 999 WP_241390308 hypothetical protein trbB
MOO97_RS00200 (12dp_00067) 34586..35896 - 1311 WP_241390430 conjugal transfer protein TrbA trbA
MOO97_RS00205 (12dp_00066) 36025..36603 - 579 WP_241389923 hypothetical protein -
MOO97_RS00210 (12dp_00065) 36600..38894 - 2295 WP_261097221 DotA/TraY family protein -
MOO97_RS00215 (12dp_00064) 38809..39372 - 564 WP_241390311 conjugal transfer protein TraX -
MOO97_RS00220 (12dp_00063) 39365..40591 - 1227 WP_241390312 conjugal transfer protein TraW traW
MOO97_RS00225 (12dp_00061) 40732..43806 - 3075 WP_241390313 type IV secretory system conjugative DNA transfer family protein traU
MOO97_RS00230 (12dp_00060) 43809..44414 - 606 WP_241389875 hypothetical protein traT
MOO97_RS00235 (12dp_00059) 44501..44902 - 402 WP_241389604 DUF6750 family protein traR
MOO97_RS00240 (12dp_00058) 44918..45448 - 531 WP_241389877 conjugal transfer protein TraQ traQ
MOO97_RS00245 (12dp_00057) 45457..46200 - 744 WP_241390314 hypothetical protein traP
MOO97_RS00250 (12dp_00056) 46200..47432 - 1233 WP_241389929 conjugal transfer protein TraO traO
MOO97_RS00255 (12dp_00055) 47436..48443 - 1008 WP_241390316 DotH/IcmK family type IV secretion protein traN
MOO97_RS00260 (12dp_00054) 48446..49120 - 675 WP_241390317 DotI/IcmL/TraM family protein traM
MOO97_RS00265 (12dp_00053) 49211..49702 - 492 WP_010895743 hypothetical protein traL
MOO97_RS00270 (12dp_00052) 49712..52948 - 3237 WP_241390318 LPD7 domain-containing protein -
MOO97_RS00275 (12dp_00050) 53091..53357 - 267 WP_241390319 IcmT/TraK family protein traK
MOO97_RS00280 (12dp_00049) 53357..54514 - 1158 WP_241389933 plasmid transfer ATPase TraJ virB11
MOO97_RS00285 (12dp_00047) 54704..55492 - 789 WP_010895747 type IV secretory system conjugative DNA transfer family protein traI
MOO97_RS00290 (12dp_00046) 55489..55947 - 459 WP_010895748 DotD/TraH family lipoprotein -
MOO97_RS00295 (12dp_00045) 55985..57418 - 1434 WP_010895749 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOO97_RS00300 (12dp_00044) 57415..58083 - 669 WP_241390170 prepilin peptidase -
MOO97_RS00305 (12dp_00043) 58083..58568 - 486 WP_010895751 lytic transglycosylase domain-containing protein virB1
MOO97_RS00310 (12dp_00042) 58623..59216 - 594 WP_010895752 type 4 pilus major pilin -
MOO97_RS00315 (12dp_00041) 59252..60364 - 1113 WP_241389818 type II secretion system F family protein -
MOO97_RS00320 (12dp_00040) 60364..61854 - 1491 WP_241389888 ATPase, T2SS/T4P/T4SS family virB11
MOO97_RS00325 (12dp_00039) 61860..62444 - 585 WP_241389889 type IV pilus biogenesis protein PilP -
MOO97_RS00330 (12dp_00038) 62431..63741 - 1311 WP_241390279 type 4b pilus protein PilO2 -
MOO97_RS00335 (12dp_00037) 63745..65379 - 1635 WP_241389891 PilN family type IVB pilus formation outer membrane protein -
MOO97_RS00340 (12dp_00036) 65401..65826 - 426 WP_241389892 type IV pilus biogenesis protein PilM -
MOO97_RS00345 (12dp_00035) 65826..66839 - 1014 WP_241390280 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3912 GenBank   NZ_MT039175
Plasmid name   AGR_12d|unnamed1 Incompatibility group   -
Plasmid size   145377 bp Coordinate of oriT [Strand]   22696..22778 [+]
Host baterium   Serratia proteamaculans strain AGR_12d

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -