Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103463
Name   oriT_AGR_F28|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_F28
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039207 (70458..70539 [+], 82 nt)
oriT length   82 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_AGR_F28|unnamed1
CGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   2586 GenBank   WP_241390631
Name   Relaxase_MOP05_RS00375_AGR_F28|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73670.85 Da        Isoelectric Point: 6.9859

>WP_241390631.1 TraI/MobA(P) family conjugative relaxase [Serratia proteamaculans]
MIIRIPEKRRDGKSSFLQLVAYTVVRDEDKPDTPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDADLQQI
MHADPHGHTQVMFDGVMCETNCFNITTASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKSLTPSGAKALEYYADVESLHTYAVTECGFKIDEAMADPNLTWKDVHRILVNAGLAL
KPKGKGLAIYSIDNPELPPVKASSVHPDLTLGCLEKDLGLFQPLENVGTYTKDYTTTATDAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQTYKHAWKRPKLDANVVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLAVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPISTNSIVFAVADDTPAFALDGYATQVTRDGTVQYMHDGCVELQDKGERIEVGDHRVNEGEHIA
GGMALAENKSGEHLKFEGESDFVQQACSMVRWFNEGGEEPLPLSDPQQRMMAGYDAYSQTISTGDGQHTP
SAAEQPNVEQSKPRSGYRPQQ

  Protein domains


Predicted by InterproScan.

(55-318)

(518-590)


  Protein structure



No available structure.




T4CP


ID   2385 GenBank   WP_241390633
Name   trbC_MOP05_RS00390_AGR_F28|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81741.52 Da        Isoelectric Point: 8.3731

>WP_241390633.1 F-type conjugative transfer protein TrbC [Serratia proteamaculans]
MTRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIVGFIMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRHPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELINKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPITMDELGAYFGQGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMASSLPMRINRFIDVETPTEAELFTLNPSLKRKLPPAAQEIDG
ILQRLEQAMDTTTSAGMMDPVLKRVAAVALDLDNRADVSYSPTQRGVLLFEAAREALHQNKRNWRHLPSP
PKPIRVSKEVAQSLANAGTNQITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 2215..24588

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOP05_RS00010 (F28p_00001) 1659..2222 - 564 WP_241390638 conjugal transfer protein TraX -
MOP05_RS00015 (F28p_00002) 2215..3441 - 1227 WP_241390639 conjugal transfer protein TraW traW
MOP05_RS00020 (F28p_00004) 3582..6656 - 3075 WP_241390640 type IV secretory system conjugative DNA transfer family protein traU
MOP05_RS00025 (F28p_00005) 6659..7264 - 606 WP_241390641 hypothetical protein traT
MOP05_RS00030 (F28p_00006) 7349..7750 - 402 WP_241390642 DUF6750 family protein traR
MOP05_RS00035 (F28p_00007) 7766..8296 - 531 WP_010895872 conjugal transfer protein TraQ traQ
MOP05_RS00040 (F28p_00008) 8305..9048 - 744 WP_241390643 hypothetical protein traP
MOP05_RS00045 (F28p_00009) 9048..10280 - 1233 WP_241390644 conjugal transfer protein TraO traO
MOP05_RS00050 (F28p_00010) 10285..11292 - 1008 WP_241390645 DotH/IcmK family type IV secretion protein traN
MOP05_RS00055 (F28p_00011) 11295..11969 - 675 WP_241390646 DotI/IcmL/TraM family protein traM
MOP05_RS00060 (F28p_00012) 12060..12551 - 492 WP_241390647 hypothetical protein traL
MOP05_RS00065 (F28p_00013) 12561..15794 - 3234 WP_241390648 LPD7 domain-containing protein -
MOP05_RS00070 (F28p_00015) 15937..16203 - 267 WP_241390675 IcmT/TraK family protein traK
MOP05_RS00075 (F28p_00016) 16254..17411 - 1158 WP_115185023 plasmid transfer ATPase TraJ virB11
MOP05_RS00080 (F28p_00017) 17442..18230 - 789 WP_241390649 type IV secretory system conjugative DNA transfer family protein traI
MOP05_RS00085 (F28p_00018) 18227..18652 - 426 WP_241390650 DotD/TraH family lipoprotein -
MOP05_RS00090 (F28p_00019) 18722..20188 - 1467 WP_241390651 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOP05_RS00095 (F28p_00020) 20152..20814 - 663 WP_241390652 A24 family peptidase -
MOP05_RS00100 (F28p_00021) 20820..21305 - 486 WP_241390653 lytic transglycosylase domain-containing protein virB1
MOP05_RS00105 (F28p_00022) 21360..21950 - 591 WP_115185017 type 4 pilus major pilin -
MOP05_RS00110 (F28p_00023) 21986..23101 - 1116 WP_241390654 type II secretion system F family protein -
MOP05_RS00115 (F28p_00024) 23098..24588 - 1491 WP_241390655 ATPase, T2SS/T4P/T4SS family virB11
MOP05_RS00120 (F28p_00025) 24594..25178 - 585 WP_241390656 type IV pilus biogenesis protein PilP -
MOP05_RS00125 (F28p_00026) 25165..26367 - 1203 WP_241390657 type 4b pilus protein PilO2 -
MOP05_RS00130 (F28p_00027) 26473..28107 - 1635 WP_241390658 PilN family type IVB pilus formation outer membrane protein -
MOP05_RS00135 (F28p_00028) 28130..28555 - 426 WP_017891030 type IV pilus biogenesis protein PilM -
MOP05_RS00140 (F28p_00029) 28555..29580 - 1026 WP_241390661 toxin co-regulated pilus biosynthesis Q family protein -

Region 2: 76006..104183

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOP05_RS00380 (F28p_00076) 72911..73234 - 324 WP_129935345 hypothetical protein -
MOP05_RS00385 (F28p_00077) 73244..73780 - 537 WP_241390632 phospholipase D family protein -
MOP05_RS00390 (F28p_00078) 73791..75968 - 2178 WP_241390633 F-type conjugative transfer protein TrbC -
MOP05_RS00395 (F28p_00079) 76006..77019 - 1014 WP_241390634 hypothetical protein trbB
MOP05_RS00400 (F28p_00080) 77033..78292 - 1260 WP_241390635 conjugal transfer protein TrbA trbA
MOP05_RS00405 (F28p_00081) 78470..79048 - 579 WP_241390636 hypothetical protein -
MOP05_RS00410 (F28p_00082) 79045..81189 - 2145 WP_241390637 DotA/TraY family protein traY
MOP05_RS00415 (F28p_00083) 81254..81817 - 564 WP_241390638 conjugal transfer protein TraX -
MOP05_RS00420 (F28p_00084) 81810..83036 - 1227 WP_241390639 conjugal transfer protein TraW traW
MOP05_RS00425 (F28p_00086) 83177..86251 - 3075 WP_241390640 type IV secretory system conjugative DNA transfer family protein traU
MOP05_RS00430 (F28p_00087) 86254..86859 - 606 WP_241390641 hypothetical protein traT
MOP05_RS00435 (F28p_00088) 86944..87345 - 402 WP_241390642 DUF6750 family protein traR
MOP05_RS00440 (F28p_00089) 87361..87891 - 531 WP_010895872 conjugal transfer protein TraQ traQ
MOP05_RS00445 (F28p_00090) 87900..88643 - 744 WP_241390643 hypothetical protein traP
MOP05_RS00450 (F28p_00091) 88643..89875 - 1233 WP_241390644 conjugal transfer protein TraO traO
MOP05_RS00455 (F28p_00092) 89880..90887 - 1008 WP_241390645 DotH/IcmK family type IV secretion protein traN
MOP05_RS00460 (F28p_00093) 90890..91564 - 675 WP_241390646 DotI/IcmL/TraM family protein traM
MOP05_RS00465 (F28p_00094) 91655..92146 - 492 WP_241390647 hypothetical protein traL
MOP05_RS00470 (F28p_00095) 92156..95389 - 3234 WP_241390648 LPD7 domain-containing protein -
MOP05_RS00475 (F28p_00097) 95532..95798 - 267 WP_241390675 IcmT/TraK family protein traK
MOP05_RS00480 (F28p_00098) 95849..97006 - 1158 WP_115185023 plasmid transfer ATPase TraJ virB11
MOP05_RS00485 (F28p_00099) 97037..97825 - 789 WP_241390649 type IV secretory system conjugative DNA transfer family protein traI
MOP05_RS00490 (F28p_00100) 97822..98247 - 426 WP_241390650 DotD/TraH family lipoprotein -
MOP05_RS00495 (F28p_00101) 98317..99783 - 1467 WP_241390651 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOP05_RS00500 (F28p_00102) 99747..100409 - 663 WP_241390652 A24 family peptidase -
MOP05_RS00505 (F28p_00103) 100415..100900 - 486 WP_241390653 lytic transglycosylase domain-containing protein virB1
MOP05_RS00510 (F28p_00104) 100955..101545 - 591 WP_115185017 type 4 pilus major pilin -
MOP05_RS00515 (F28p_00105) 101581..102696 - 1116 WP_241390654 type II secretion system F family protein -
MOP05_RS00520 (F28p_00106) 102693..104183 - 1491 WP_241390655 ATPase, T2SS/T4P/T4SS family virB11
MOP05_RS00525 (F28p_00107) 104189..104773 - 585 WP_241390656 type IV pilus biogenesis protein PilP -
MOP05_RS00530 (F28p_00108) 104760..105962 - 1203 WP_241390657 type 4b pilus protein PilO2 -
MOP05_RS00535 (F28p_00109) 106068..107702 - 1635 WP_241390658 PilN family type IVB pilus formation outer membrane protein -
MOP05_RS00540 (F28p_00110) 107725..108150 - 426 WP_017891030 type IV pilus biogenesis protein PilM -
MOP05_RS00545 (F28p_00111) 108150..108455 - 306 WP_241390659 toxin co-regulated pilus biosynthesis Q family protein -


Host bacterium


ID   3906 GenBank   NZ_MT039207
Plasmid name   AGR_F28|unnamed1 Incompatibility group   -
Plasmid size   108588 bp Coordinate of oriT [Strand]   70458..70539 [+]
Host baterium   Serratia proteamaculans strain AGR_F28

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -