Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103459
Name   oriT_AGR_299|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_299
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039187 (22620..22702 [+], 83 nt)
oriT length   83 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 83 nt

>oriT_AGR_299|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAAGGCTGGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2583 GenBank   WP_241390305
Name   Relaxase_MOO84_RS00140_AGR_299|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73396.69 Da        Isoelectric Point: 7.3282

>WP_241390305.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIIRIPEKRRDGKSSFLQLVAYTVVRDEDKPDSPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDVDLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKVADDCFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVSECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKGKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDLGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKCPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
GGMALAENKSGEHLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRPGHRPQQ

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)


  Protein structure



No available structure.




T4CP

ID   2380 GenBank   WP_241390158
Name   trbC_MOO84_RS00180_AGR_299|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81527.35 Da        Isoelectric Point: 8.3675

>WP_241390158.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 33499..62986

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOO84_RS00170 (299p_00037) 29708..30652 + 945 WP_241389593 hypothetical protein -
MOO84_RS00175 (299p_00038) 30788..31273 - 486 WP_241389866 phospholipase D-like domain-containing protein -
MOO84_RS00180 (299p_00039) 31284..33461 - 2178 WP_241390158 F-type conjugative transfer protein TrbC -
MOO84_RS00185 (299p_00040) 33499..34497 - 999 WP_241390308 hypothetical protein trbB
MOO84_RS00190 (299p_00041) 34679..35719 - 1041 WP_241390309 IS481 family transposase -
MOO84_RS00195 (299p_00042) 35814..36977 - 1164 WP_241390310 conjugal transfer protein TrbA trbA
MOO84_RS00200 (299p_00043) 37157..37735 - 579 WP_241389923 hypothetical protein -
MOO84_RS00205 (299p_00044) 37732..40026 - 2295 WP_261097221 DotA/TraY family protein -
MOO84_RS00210 (299p_00045) 39941..40504 - 564 WP_241390311 conjugal transfer protein TraX -
MOO84_RS00215 (299p_00046) 40497..41723 - 1227 WP_241390312 conjugal transfer protein TraW traW
MOO84_RS00220 (299p_00048) 41864..44938 - 3075 WP_241390313 type IV secretory system conjugative DNA transfer family protein traU
MOO84_RS00225 (299p_00049) 44941..45546 - 606 WP_241389875 hypothetical protein traT
MOO84_RS00230 (299p_00050) 45633..46034 - 402 WP_241389604 DUF6750 family protein traR
MOO84_RS00235 (299p_00051) 46050..46580 - 531 WP_241389877 conjugal transfer protein TraQ traQ
MOO84_RS00240 (299p_00052) 46589..47332 - 744 WP_241390314 hypothetical protein traP
MOO84_RS00245 (299p_00053) 47332..48564 - 1233 WP_241390315 conjugal transfer protein TraO traO
MOO84_RS00250 (299p_00054) 48568..49575 - 1008 WP_241390316 DotH/IcmK family type IV secretion protein traN
MOO84_RS00255 (299p_00055) 49578..50252 - 675 WP_241390317 DotI/IcmL/TraM family protein traM
MOO84_RS00260 (299p_00056) 50343..50834 - 492 WP_010895743 hypothetical protein traL
MOO84_RS00265 (299p_00057) 50844..54080 - 3237 WP_241390318 LPD7 domain-containing protein -
MOO84_RS00270 (299p_00059) 54223..54489 - 267 WP_241390319 IcmT/TraK family protein traK
MOO84_RS00275 (299p_00060) 54489..55646 - 1158 WP_241389933 plasmid transfer ATPase TraJ virB11
MOO84_RS00280 (299p_00062) 55836..56624 - 789 WP_010895747 type IV secretory system conjugative DNA transfer family protein traI
MOO84_RS00285 (299p_00063) 56621..57079 - 459 WP_010895748 DotD/TraH family lipoprotein -
MOO84_RS00290 (299p_00064) 57117..58550 - 1434 WP_010895749 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOO84_RS00295 (299p_00065) 58547..59215 - 669 WP_241390170 prepilin peptidase -
MOO84_RS00300 (299p_00066) 59215..59700 - 486 WP_010895751 lytic transglycosylase domain-containing protein virB1
MOO84_RS00305 (299p_00067) 59755..60348 - 594 WP_010895752 type 4 pilus major pilin -
MOO84_RS00310 (299p_00068) 60384..61496 - 1113 WP_241389818 type II secretion system F family protein -
MOO84_RS00315 (299p_00069) 61496..62986 - 1491 WP_241389888 ATPase, T2SS/T4P/T4SS family virB11
MOO84_RS00320 (299p_00070) 62992..63576 - 585 WP_241389889 type IV pilus biogenesis protein PilP -
MOO84_RS00325 (299p_00071) 63563..64873 - 1311 WP_241390279 type 4b pilus protein PilO2 -
MOO84_RS00330 (299p_00072) 64877..66511 - 1635 WP_241389891 PilN family type IVB pilus formation outer membrane protein -
MOO84_RS00335 (299p_00073) 66533..66958 - 426 WP_241389892 type IV pilus biogenesis protein PilM -
MOO84_RS00340 (299p_00074) 66958..67971 - 1014 WP_241390280 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3902 GenBank   NZ_MT039187
Plasmid name   AGR_299|unnamed1 Incompatibility group   -
Plasmid size   112046 bp Coordinate of oriT [Strand]   22620..22702 [+]
Host baterium   Serratia proteamaculans strain AGR_299

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -