Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103456
Name   oriT_AGR_CfB|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_CfB
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039204 (21474..21555 [+], 82 nt)
oriT length   82 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_AGR_CfB|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGTGCCCCGACACCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2580 GenBank   WP_241389921
Name   Relaxase_MOP04_RS00130_AGR_CfB|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73479.70 Da        Isoelectric Point: 7.4607

>WP_241389921.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIIRIPEKRRDGKSSFLQLVAYTVVRDDDKPDTPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDVGLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVTECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKEKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDLGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKRPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
SGMALAENKSGEYLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRSGHRPQQ

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)


  Protein structure



No available structure.




T4CP

ID   2377 GenBank   WP_241389595
Name   trbC_MOP04_RS00170_AGR_CfB|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81541.37 Da        Isoelectric Point: 8.3675

>WP_241389595.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDILHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 32352..60658

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOP04_RS00160 (CfBp_00041) 28561..29505 + 945 WP_241389593 hypothetical protein -
MOP04_RS00165 (CfBp_00042) 29641..30126 - 486 WP_241389594 phospholipase D-like domain-containing protein -
MOP04_RS00170 (CfBp_00043) 30137..32314 - 2178 WP_241389595 F-type conjugative transfer protein TrbC -
MOP04_RS00175 (CfBp_00044) 32352..33350 - 999 WP_241390915 hypothetical protein trbB
MOP04_RS00180 (CfBp_00045) 33362..34672 - 1311 WP_241390916 conjugal transfer protein TrbA trbA
MOP04_RS00185 (CfBp_00047) 34811..35392 - 582 WP_241390917 hypothetical protein -
MOP04_RS00190 (CfBp_00048) 35389..37533 - 2145 WP_241390918 DotA/TraY family protein traY
MOP04_RS00195 (CfBp_00049) 37598..38170 - 573 WP_241390359 conjugal transfer protein TraX -
MOP04_RS00200 (CfBp_00050) 38163..39389 - 1227 WP_241389601 conjugal transfer protein TraW traW
MOP04_RS00205 (CfBp_00052) 39530..42604 - 3075 WP_241389602 type IV secretory system conjugative DNA transfer family protein traU
MOP04_RS00210 (CfBp_00053) 42607..43212 - 606 WP_241389603 hypothetical protein traT
MOP04_RS00215 (CfBp_00054) 43299..43700 - 402 WP_241389604 DUF6750 family protein traR
MOP04_RS00220 (CfBp_00055) 43716..44246 - 531 WP_241389605 conjugal transfer protein TraQ traQ
MOP04_RS00225 (CfBp_00056) 44255..45004 - 750 WP_241389606 hypothetical protein traP
MOP04_RS00230 (CfBp_00057) 45004..46236 - 1233 WP_241389607 conjugal transfer protein TraO traO
MOP04_RS00235 (CfBp_00058) 46240..47247 - 1008 WP_241390919 DotH/IcmK family type IV secretion protein traN
MOP04_RS00240 (CfBp_00059) 47250..47924 - 675 WP_010895742 DotI/IcmL/TraM family protein traM
MOP04_RS00245 (CfBp_00060) 48015..48506 - 492 WP_241389610 hypothetical protein traL
MOP04_RS00250 (CfBp_00061) 48516..51752 - 3237 WP_241389611 LPD7 domain-containing protein -
MOP04_RS00255 (CfBp_00063) 51895..52161 - 267 WP_241389612 IcmT/TraK family protein traK
MOP04_RS00260 (CfBp_00064) 52161..53318 - 1158 WP_241389613 plasmid transfer ATPase TraJ virB11
MOP04_RS00265 (CfBp_00065) 53508..54296 - 789 WP_010895747 type IV secretory system conjugative DNA transfer family protein traI
MOP04_RS00270 (CfBp_00066) 54293..54751 - 459 WP_241389614 DotD/TraH family lipoprotein -
MOP04_RS00275 (CfBp_00067) 54789..56222 - 1434 WP_241389615 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOP04_RS00280 (CfBp_00068) 56219..56887 - 669 WP_241389616 prepilin peptidase -
MOP04_RS00285 (CfBp_00069) 56887..57372 - 486 WP_241389617 lytic transglycosylase domain-containing protein virB1
MOP04_RS00290 (CfBp_00070) 57427..58020 - 594 WP_010895752 type 4 pilus major pilin -
MOP04_RS00295 (CfBp_00071) 58056..59108 - 1053 WP_241390342 type II secretion system F family protein -
MOP04_RS00300 (CfBp_00072) 59168..60658 - 1491 WP_010895754 ATPase, T2SS/T4P/T4SS family virB11
MOP04_RS00305 (CfBp_00073) 60664..61248 - 585 WP_241389531 type IV pilus biogenesis protein PilP -
MOP04_RS00310 (CfBp_00074) 61235..62545 - 1311 WP_241389532 type 4b pilus protein PilO2 -
MOP04_RS00315 (CfBp_00075) 62549..64183 - 1635 WP_241389533 PilN family type IVB pilus formation outer membrane protein -
MOP04_RS00320 (CfBp_00076) 64208..64633 - 426 WP_010895758 type IV pilus biogenesis protein PilM -
MOP04_RS00325 (CfBp_00077) 64633..65646 - 1014 WP_241389534 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3899 GenBank   NZ_MT039204
Plasmid name   AGR_CfB|unnamed1 Incompatibility group   -
Plasmid size   114603 bp Coordinate of oriT [Strand]   21474..21555 [+]
Host baterium   Serratia proteamaculans strain AGR_CfB

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -