Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103451
Name   oriT_AGR_1048|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_1048
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039193 (21389..21470 [+], 82 nt)
oriT length   82 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_AGR_1048|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGTGCCCCGACACCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2575 GenBank   WP_241389921
Name   Relaxase_MOO91_RS00130_AGR_1048|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73479.70 Da        Isoelectric Point: 7.4607

>WP_241389921.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIIRIPEKRRDGKSSFLQLVAYTVVRDDDKPDTPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDVGLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVTECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKEKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDLGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKRPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
SGMALAENKSGEYLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRSGHRPQQ

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)


  Protein structure



No available structure.




T4CP

ID   2372 GenBank   WP_241389595
Name   trbC_MOO91_RS00170_AGR_1048|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81541.37 Da        Isoelectric Point: 8.3675

>WP_241389595.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDILHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 32264..60541

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOO91_RS00515 (1048p_00012) 28474..28794 + 321 WP_336287011 hypothetical protein -
MOO91_RS00160 28785..29417 + 633 WP_318035688 hypothetical protein -
MOO91_RS00165 (1048p_00014) 29553..30038 - 486 WP_241389594 phospholipase D-like domain-containing protein -
MOO91_RS00170 (1048p_00015) 30049..32226 - 2178 WP_241389595 F-type conjugative transfer protein TrbC -
MOO91_RS00175 (1048p_00016) 32264..33262 - 999 WP_241389596 hypothetical protein trbB
MOO91_RS00180 (1048p_00017) 33274..34584 - 1311 WP_241389922 conjugal transfer protein TrbA trbA
MOO91_RS00185 (1048p_00018) 34713..35291 - 579 WP_241389923 hypothetical protein -
MOO91_RS00190 (1048p_00019) 35288..37582 - 2295 WP_261166663 DotA/TraY family protein -
MOO91_RS00195 (1048p_00020) 37497..38060 - 564 WP_241389924 conjugal transfer protein TraX -
MOO91_RS00200 (1048p_00021) 38053..39279 - 1227 WP_241389925 conjugal transfer protein TraW traW
MOO91_RS00205 (1048p_00023) 39420..42494 - 3075 WP_241389926 type IV secretory system conjugative DNA transfer family protein traU
MOO91_RS00210 (1048p_00024) 42497..43102 - 606 WP_241389927 hypothetical protein traT
MOO91_RS00215 (1048p_00025) 43189..43590 - 402 WP_241389604 DUF6750 family protein traR
MOO91_RS00220 (1048p_00026) 43606..44136 - 531 WP_241389877 conjugal transfer protein TraQ traQ
MOO91_RS00225 (1048p_00027) 44145..44888 - 744 WP_241389928 hypothetical protein traP
MOO91_RS00230 (1048p_00028) 44888..46120 - 1233 WP_241389929 conjugal transfer protein TraO traO
MOO91_RS00235 (1048p_00029) 46124..47131 - 1008 WP_241389930 DotH/IcmK family type IV secretion protein traN
MOO91_RS00240 (1048p_00030) 47134..47820 - 687 WP_241389609 DotI/IcmL/TraM family protein traM
MOO91_RS00245 (1048p_00031) 47899..48390 - 492 WP_010895743 hypothetical protein traL
MOO91_RS00250 (1048p_00032) 48400..51636 - 3237 WP_241389931 LPD7 domain-containing protein -
MOO91_RS00255 (1048p_00034) 51779..52045 - 267 WP_241389932 IcmT/TraK family protein traK
MOO91_RS00260 (1048p_00035) 52045..53202 - 1158 WP_241389933 plasmid transfer ATPase TraJ virB11
MOO91_RS00265 (1048p_00037) 53392..54180 - 789 WP_010895747 type IV secretory system conjugative DNA transfer family protein traI
MOO91_RS00270 (1048p_00038) 54177..54635 - 459 WP_010895748 DotD/TraH family lipoprotein -
MOO91_RS00275 54673..55068 - 396 WP_241390445 prepilin, shufflon protein A -
MOO91_RS00280 (1048p_00039) 55068..56105 - 1038 WP_241390446 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOO91_RS00285 (1048p_00040) 56102..56770 - 669 WP_241389885 prepilin peptidase -
MOO91_RS00290 (1048p_00041) 56770..57255 - 486 WP_241389886 lytic transglycosylase domain-containing protein virB1
MOO91_RS00295 (1048p_00042) 57310..57903 - 594 WP_010895752 type 4 pilus major pilin -
MOO91_RS00300 (1048p_00043) 57939..59051 - 1113 WP_241389887 type II secretion system F family protein -
MOO91_RS00305 (1048p_00044) 59051..60541 - 1491 WP_241389888 ATPase, T2SS/T4P/T4SS family virB11
MOO91_RS00310 (1048p_00045) 60547..61131 - 585 WP_241389889 type IV pilus biogenesis protein PilP -
MOO91_RS00315 (1048p_00046) 61118..62428 - 1311 WP_241389890 type 4b pilus protein PilO2 -
MOO91_RS00320 (1048p_00047) 62432..64066 - 1635 WP_241389891 PilN family type IVB pilus formation outer membrane protein -
MOO91_RS00325 (1048p_00048) 64088..64513 - 426 WP_241389892 type IV pilus biogenesis protein PilM -
MOO91_RS00330 (1048p_00049) 64513..65526 - 1014 WP_241389893 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3894 GenBank   NZ_MT039193
Plasmid name   AGR_1048|unnamed1 Incompatibility group   -
Plasmid size   108212 bp Coordinate of oriT [Strand]   21389..21470 [+]
Host baterium   Serratia proteamaculans strain AGR_1048

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -