Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103448
Name   oriT_AGR_1A|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_1A
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039172 (21339..21420 [+], 82 nt)
oriT length   82 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_AGR_1A|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGAGCCCCGACACCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2572 GenBank   WP_241390156
Name   Relaxase_MOO82_RS00130_AGR_1A|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73425.56 Da        Isoelectric Point: 7.4607

>WP_241390156.1 TraI/MobA(P) family conjugative relaxase [Serratia proteamaculans]
MIIRIPEKRRDGKSSFLQLVAYTVVRDDDKPDTPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDAGLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVTECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKEKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDLGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKRPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LSRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
SGMALAENKSGEYLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRSGHRPQQ

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)


  Protein structure



No available structure.




T4CP

ID   2369 GenBank   WP_241390332
Name   trbC_MOO82_RS00170_AGR_1A|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81557.37 Da        Isoelectric Point: 8.3675

>WP_241390332.1 F-type conjugative transfer protein TrbC [Serratia proteamaculans]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISTIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 32218..60506

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOO82_RS00160 (1Ap1_00028) 28427..29371 + 945 WP_241389593 hypothetical protein -
MOO82_RS00165 (1Ap1_00029) 29507..29992 - 486 WP_241389866 phospholipase D-like domain-containing protein -
MOO82_RS00170 (1Ap1_00030) 30003..32180 - 2178 WP_241390332 F-type conjugative transfer protein TrbC -
MOO82_RS00175 (1Ap1_00031) 32218..33216 - 999 WP_241389596 hypothetical protein trbB
MOO82_RS00180 (1Ap1_00032) 33228..34538 - 1311 WP_241390159 conjugal transfer protein TrbA trbA
MOO82_RS00185 (1Ap1_00033) 34677..35219 - 543 WP_241390160 hypothetical protein -
MOO82_RS00190 (1Ap1_00034) 35255..37549 - 2295 WP_241390161 DotA/TraY family protein traY
MOO82_RS00195 (1Ap1_00035) 37464..38027 - 564 WP_241390162 conjugal transfer protein TraX -
MOO82_RS00200 (1Ap1_00036) 38020..39246 - 1227 WP_010895868 conjugal transfer protein TraW traW
MOO82_RS00205 (1Ap1_00038) 39387..42461 - 3075 WP_241390163 type IV secretory system conjugative DNA transfer family protein traU
MOO82_RS00210 (1Ap1_00039) 42464..43069 - 606 WP_241390164 hypothetical protein traT
MOO82_RS00215 (1Ap1_00040) 43155..43556 - 402 WP_010895871 DUF6750 family protein traR
MOO82_RS00220 (1Ap1_00041) 43572..44102 - 531 WP_010895872 conjugal transfer protein TraQ traQ
MOO82_RS00225 (1Ap1_00042) 44111..44854 - 744 WP_241390165 hypothetical protein traP
MOO82_RS00230 (1Ap1_00043) 44854..46086 - 1233 WP_241390166 conjugal transfer protein TraO traO
MOO82_RS00235 (1Ap1_00044) 46091..47098 - 1008 WP_241390167 DotH/IcmK family type IV secretion protein traN
MOO82_RS00240 (1Ap1_00045) 47101..47775 - 675 WP_010895742 DotI/IcmL/TraM family protein traM
MOO82_RS00245 (1Ap1_00046) 47866..48357 - 492 WP_010895743 hypothetical protein traL
MOO82_RS00250 (1Ap1_00047) 48367..51600 - 3234 WP_241390333 LPD7 domain-containing protein -
MOO82_RS00255 (1Ap1_00049) 51743..52009 - 267 WP_241390169 IcmT/TraK family protein traK
MOO82_RS00260 (1Ap1_00050) 52009..53166 - 1158 WP_241389933 plasmid transfer ATPase TraJ virB11
MOO82_RS00265 (1Ap1_00052) 53356..54144 - 789 WP_010895747 type IV secretory system conjugative DNA transfer family protein traI
MOO82_RS00270 (1Ap1_00053) 54141..54599 - 459 WP_010895748 DotD/TraH family lipoprotein -
MOO82_RS00275 (1Ap1_00054) 54637..56070 - 1434 WP_241390334 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOO82_RS00280 (1Ap1_00055) 56067..56735 - 669 WP_241390335 prepilin peptidase -
MOO82_RS00285 (1Ap1_00056) 56735..57220 - 486 WP_010895751 lytic transglycosylase domain-containing protein virB1
MOO82_RS00290 (1Ap1_00057) 57275..57868 - 594 WP_010895752 type 4 pilus major pilin -
MOO82_RS00295 (1Ap1_00058) 57904..59016 - 1113 WP_241389818 type II secretion system F family protein -
MOO82_RS00300 (1Ap1_00059) 59016..60506 - 1491 WP_241390323 ATPase, T2SS/T4P/T4SS family virB11
MOO82_RS00305 (1Ap1_00060) 60512..61096 - 585 WP_241389889 type IV pilus biogenesis protein PilP -
MOO82_RS00310 (1Ap1_00061) 61083..62393 - 1311 WP_241389532 type 4b pilus protein PilO2 -
MOO82_RS00315 (1Ap1_00062) 62397..64031 - 1635 WP_241390126 PilN family type IVB pilus formation outer membrane protein -
MOO82_RS00320 (1Ap1_00063) 64056..64481 - 426 WP_010895758 type IV pilus biogenesis protein PilM -
MOO82_RS00325 (1Ap1_00064) 64481..65494 - 1014 WP_241390127 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3891 GenBank   NZ_MT039172
Plasmid name   AGR_1A|unnamed1 Incompatibility group   -
Plasmid size   113035 bp Coordinate of oriT [Strand]   21339..21420 [+]
Host baterium   Serratia proteamaculans strain AGR_1A

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -