Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103447
Name   oriT_AGR_4|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_4
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039173 (21374..21455 [+], 82 nt)
oriT length   82 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_AGR_4|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGTGCCCCGACACCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2571 GenBank   WP_241389589
Name   Relaxase_MOO78_RS00135_AGR_4|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73493.72 Da        Isoelectric Point: 7.4608

>WP_241389589.1 TraI/MobA(P) family conjugative relaxase [Serratia proteamaculans]
MIIRIPEKRRDGKSSFLQLVAYTVVRDDDKPDTPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDVGLQQI
MHAEPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVTECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKEKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDLGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKRPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
SGMALAENKSGEYLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRSGHRPQQ

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)


  Protein structure



No available structure.




T4CP

ID   2368 GenBank   WP_241389595
Name   trbC_MOO78_RS00175_AGR_4|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81541.37 Da        Isoelectric Point: 8.3675

>WP_241389595.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDILHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 32252..60558

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOO78_RS00165 (4p_00052) 28461..29405 + 945 WP_241389593 hypothetical protein -
MOO78_RS00170 (4p_00053) 29541..30026 - 486 WP_241389594 phospholipase D-like domain-containing protein -
MOO78_RS00175 (4p_00054) 30037..32214 - 2178 WP_241389595 F-type conjugative transfer protein TrbC -
MOO78_RS00180 (4p_00055) 32252..33250 - 999 WP_241389596 hypothetical protein trbB
MOO78_RS00185 (4p_00056) 33262..34572 - 1311 WP_241389597 conjugal transfer protein TrbA trbA
MOO78_RS00190 (4p_00057) 34711..35253 - 543 WP_241389598 hypothetical protein -
MOO78_RS00195 (4p_00058) 35289..37433 - 2145 WP_241389599 DotA/TraY family protein traY
MOO78_RS00200 (4p_00059) 37498..38070 - 573 WP_241389600 conjugal transfer protein TraX -
MOO78_RS00205 (4p_00060) 38063..39289 - 1227 WP_241389601 conjugal transfer protein TraW traW
MOO78_RS00210 (4p_00062) 39430..42504 - 3075 WP_241389602 type IV secretory system conjugative DNA transfer family protein traU
MOO78_RS00215 (4p_00063) 42507..43112 - 606 WP_241389603 hypothetical protein traT
MOO78_RS00220 (4p_00064) 43199..43600 - 402 WP_241389604 DUF6750 family protein traR
MOO78_RS00225 (4p_00065) 43616..44146 - 531 WP_241389605 conjugal transfer protein TraQ traQ
MOO78_RS00230 (4p_00066) 44155..44904 - 750 WP_241389606 hypothetical protein traP
MOO78_RS00235 (4p_00067) 44904..46136 - 1233 WP_241389607 conjugal transfer protein TraO traO
MOO78_RS00240 (4p_00068) 46140..47147 - 1008 WP_241389608 DotH/IcmK family type IV secretion protein traN
MOO78_RS00245 (4p_00069) 47150..47836 - 687 WP_241389609 DotI/IcmL/TraM family protein traM
MOO78_RS00250 (4p_00070) 47915..48406 - 492 WP_241389610 hypothetical protein traL
MOO78_RS00255 (4p_00071) 48416..51652 - 3237 WP_241389611 LPD7 domain-containing protein -
MOO78_RS00260 (4p_00073) 51795..52061 - 267 WP_241389612 IcmT/TraK family protein traK
MOO78_RS00265 (4p_00074) 52061..53218 - 1158 WP_241389613 plasmid transfer ATPase TraJ virB11
MOO78_RS00270 (4p_00076) 53408..54196 - 789 WP_010895747 type IV secretory system conjugative DNA transfer family protein traI
MOO78_RS00275 (4p_00077) 54193..54651 - 459 WP_241389614 DotD/TraH family lipoprotein -
MOO78_RS00280 (4p_00078) 54689..56122 - 1434 WP_241389615 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOO78_RS00285 (4p_00079) 56119..56787 - 669 WP_241389616 prepilin peptidase -
MOO78_RS00290 (4p_00080) 56787..57272 - 486 WP_241389617 lytic transglycosylase domain-containing protein virB1
MOO78_RS00295 (4p_00081) 57327..57920 - 594 WP_010895752 type 4 pilus major pilin -
MOO78_RS00300 (4p_00082) 57956..59008 - 1053 WP_241389530 type II secretion system F family protein -
MOO78_RS00305 (4p_00083) 59068..60558 - 1491 WP_010895754 ATPase, T2SS/T4P/T4SS family virB11
MOO78_RS00310 (4p_00084) 60564..61148 - 585 WP_241389531 type IV pilus biogenesis protein PilP -
MOO78_RS00315 (4p_00085) 61135..62445 - 1311 WP_241389532 type 4b pilus protein PilO2 -
MOO78_RS00320 (4p_00086) 62449..64083 - 1635 WP_241389533 PilN family type IVB pilus formation outer membrane protein -
MOO78_RS00325 (4p_00087) 64108..64533 - 426 WP_010895758 type IV pilus biogenesis protein PilM -
MOO78_RS00330 (4p_00088) 64533..65546 - 1014 WP_241389534 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3890 GenBank   NZ_MT039173
Plasmid name   AGR_4|unnamed1 Incompatibility group   -
Plasmid size   113715 bp Coordinate of oriT [Strand]   21374..21455 [+]
Host baterium   Serratia proteamaculans strain AGR_4

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -