Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103446
Name   oriT_AGR_1|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039171 (22270..22352 [+], 83 nt)
oriT length   83 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 83 nt

>oriT_AGR_1|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2570 GenBank   WP_241389863
Name   Relaxase_MOO81_RS00135_AGR_1|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73415.57 Da        Isoelectric Point: 7.4747

>WP_241389863.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIIRIPEKRRDGKSSFLQLVAYTVVRDEDKPDSPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDADLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVTECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKGKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDFGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKRPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
GGMALAENKSGEHLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRSGHRPQQ

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)


  Protein structure



No available structure.




T4CP

ID   2367 GenBank   WP_241390383
Name   t4cp1_MOO81_RS00175_AGR_1|unnamed1 insolico UniProt ID   _
Length   440 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 440 a.a.        Molecular weight: 49869.16 Da        Isoelectric Point: 9.3594

>WP_241390383.1 type IV secretory system conjugative DNA transfer family protein [Serratia proteamaculans]
MSRPVEVDPRRVRRPLGYTFINDALLSPIGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMSAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQSWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDVLHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFP

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 32249..60531

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOO81_RS00160 (1p_00039) 27262..27861 - 600 WP_241390381 hypothetical protein -
MOO81_RS00165 (1p_00040) 29357..30301 + 945 WP_241390382 hypothetical protein -
MOO81_RS00170 30437..30910 - 474 WP_241390391 helix-turn-helix domain-containing protein -
MOO81_RS00175 (1p_00041) 30889..32211 - 1323 WP_241390383 type IV secretory system conjugative DNA transfer family protein -
MOO81_RS00180 (1p_00042) 32249..33247 - 999 WP_241390384 hypothetical protein trbB
MOO81_RS00185 (1p_00043) 33260..34570 - 1311 WP_241390385 conjugal transfer protein TrbA trbA
MOO81_RS00190 (1p_00044) 34702..35280 - 579 WP_241389923 hypothetical protein -
MOO81_RS00195 (1p_00045) 35277..37550 - 2274 WP_336251228 DotA/TraY family protein -
MOO81_RS00200 (1p_00046) 37486..38049 - 564 WP_241389872 conjugal transfer protein TraX -
MOO81_RS00205 (1p_00047) 38042..39268 - 1227 WP_241390386 conjugal transfer protein TraW traW
MOO81_RS00210 (1p_00049) 39409..42483 - 3075 WP_241389874 type IV secretory system conjugative DNA transfer family protein traU
MOO81_RS00215 (1p_00050) 42486..43091 - 606 WP_241389875 hypothetical protein traT
MOO81_RS00220 (1p_00051) 43178..43579 - 402 WP_241389876 DUF6750 family protein traR
MOO81_RS00225 (1p_00052) 43595..44125 - 531 WP_241389877 conjugal transfer protein TraQ traQ
MOO81_RS00230 (1p_00053) 44134..44877 - 744 WP_241390387 hypothetical protein traP
MOO81_RS00235 (1p_00054) 44877..46109 - 1233 WP_241390388 conjugal transfer protein TraO traO
MOO81_RS00240 (1p_00055) 46113..47120 - 1008 WP_241390389 DotH/IcmK family type IV secretion protein traN
MOO81_RS00245 (1p_00056) 47123..47809 - 687 WP_241389609 DotI/IcmL/TraM family protein traM
MOO81_RS00250 (1p_00057) 47888..48379 - 492 WP_010895743 hypothetical protein traL
MOO81_RS00255 (1p_00058) 48389..51625 - 3237 WP_241390390 LPD7 domain-containing protein -
MOO81_RS00260 (1p_00060) 51768..52034 - 267 WP_241389612 IcmT/TraK family protein traK
MOO81_RS00265 (1p_00061) 52034..53191 - 1158 WP_241389613 plasmid transfer ATPase TraJ virB11
MOO81_RS00270 (1p_00062) 53381..54169 - 789 WP_241389822 type IV secretory system conjugative DNA transfer family protein traI
MOO81_RS00275 (1p_00063) 54166..54624 - 459 WP_241389823 DotD/TraH family lipoprotein -
MOO81_RS00280 (1p_00064) 54662..56095 - 1434 WP_241390362 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOO81_RS00285 (1p_00065) 56092..56754 - 663 WP_241390363 prepilin peptidase -
MOO81_RS00290 (1p_00066) 56760..57245 - 486 WP_010895751 lytic transglycosylase domain-containing protein virB1
MOO81_RS00295 (1p_00067) 57300..57893 - 594 WP_241390364 type 4 pilus major pilin -
MOO81_RS00300 (1p_00068) 57929..59041 - 1113 WP_241389818 type II secretion system F family protein -
MOO81_RS00305 (1p_00069) 59041..60531 - 1491 WP_241390365 ATPase, T2SS/T4P/T4SS family virB11
MOO81_RS00310 (1p_00070) 60537..61121 - 585 WP_241389889 type IV pilus biogenesis protein PilP -
MOO81_RS00315 (1p_00071) 61108..62418 - 1311 WP_241390366 type 4b pilus protein PilO2 -
MOO81_RS00320 (1p_00072) 62422..64056 - 1635 WP_241390367 PilN family type IVB pilus formation outer membrane protein -
MOO81_RS00325 (1p_00073) 64078..64503 - 426 WP_241389892 type IV pilus biogenesis protein PilM -
MOO81_RS00330 (1p_00074) 64503..65516 - 1014 WP_241390280 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3889 GenBank   NZ_MT039171
Plasmid name   AGR_1|unnamed1 Incompatibility group   -
Plasmid size   104830 bp Coordinate of oriT [Strand]   22270..22352 [+]
Host baterium   Serratia proteamaculans strain AGR_1

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -