Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103445
Name   oriT_AGR_12newD|unnamed1 in_silico
Organism   Serratia proteamaculans strain AGR_12newD
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT039176 (21390..21471 [+], 82 nt)
oriT length   82 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_AGR_12newD|unnamed1
ACGGGACCAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGTTCAACAAAACGCTGGGTCAGGGCAGTGCCCCGACACCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2569 GenBank   WP_241389921
Name   Relaxase_MOO76_RS00130_AGR_12newD|unnamed1 insolico UniProt ID   _
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 73479.70 Da        Isoelectric Point: 7.4607

>WP_241389921.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIIRIPEKRRDGKSSFLQLVAYTVVRDDDKPDTPLEPEHPGWRRPRSKDAIFNHLVDYISRNGDVGLQQI
MHADPNGHTQVMFDGVMCETNCFNIATASVEMNAVALQNTRCKDPVLHYFLSWPETDNPSTEHIFDSVRH
SLSALGMSEHQYVAAIHTDTNNIHCHVAANRIHPETYKAADDSFTRIRLQQAARELELKYNWTPTNGFFA
VNEQGEIVRSKREKNLTPSGAKTLEYYADVESLHTYAVTECGFKIDEAMADPNLAWKDIHCILVNAGLAL
KPKEKGLAIYSIDNPELPPVKASSVHPDLTLNCLEKDLGQFQLLENAGTYTKDHTTTAADAIVHEFRYEP
TLHARDLTARLERRLARADARADLKARYQAYKNAWKRPKLDAGAVKRRYQNESKRFAWQKARARVAIGDP
LLRKLTYHIIEVERMKAMAALRLTVKDERAAFKADPANRRLSYREWVEQQALSHDQAAIAQLRAFAYRMK
RTQRTAPLSTNSIVCAVADDTPAFALEGYATRVTRDGTVQYVRDGRVQLQDKGERIDVGDHRVNEGEHIA
SGMALAENKSGEYLKFEGEAAFVQQACSMVPWFNEGGDAPLPLSDPQQRTMAGYESTYQSASTGEGQRKP
SAVEQPEVEQNKPRSGHRPQQ

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(55-320)

Large polyvalent protein-associated domain 7 (LPD7)

(518-589)


  Protein structure



No available structure.




T4CP

ID   2366 GenBank   WP_241389595
Name   trbC_MOO76_RS00170_AGR_12newD|unnamed1 insolico UniProt ID   _
Length   725 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 725 a.a.        Molecular weight: 81541.37 Da        Isoelectric Point: 8.3675

>WP_241389595.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSRPVEVDPRRVRRPLGYTFINDALLSPMGVQLSLLAGLIAGFVMPATLLLTVPGLLLLVMLFADRPFRM
PLRMPTDIGGMDLTTEREMPKYRKGLGGFFRYVVRTRKYMPAAGVMCLGYARGKGLARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNSICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGTDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLSALVYAIYYKCKREKRR
ISQKVIQEYLPLRKLADLYQEAKRDGWHREAYNPLENYFNTLAGFRIELISKPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDIDIEDILHNDRILCTTIPALELSKGEASNIGKLYISAIRMTMARDLGC
ELEGMMNDVLIVKKYSGKFPYPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYAELGSVEQAGGFITPNYEDAANNYIREKDRLDLGDLKD
MSPGEGMISFKSALVPSNAIYIPDDQKMTSALPMRINRFIDVETPTEAELFALNPSLQRKLPPTAQEVDG
ILQRLDLAVDTTASVGIMDPVLKRVAAVALDLDNRADVSYSPAQRSVLLFEAAREALHKNKRKWRQLPTP
PKPIRVSKEVAQSLANAGTNEITFR

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 32268..60546

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MOO76_RS00160 (12newDp_00070) 28477..29421 + 945 WP_241389593 hypothetical protein -
MOO76_RS00165 (12newDp_00069) 29557..30042 - 486 WP_241389594 phospholipase D-like domain-containing protein -
MOO76_RS00170 (12newDp_00068) 30053..32230 - 2178 WP_241389595 F-type conjugative transfer protein TrbC -
MOO76_RS00175 (12newDp_00067) 32268..33266 - 999 WP_241389596 hypothetical protein trbB
MOO76_RS00180 (12newDp_00066) 33278..34588 - 1311 WP_241389922 conjugal transfer protein TrbA trbA
MOO76_RS00185 (12newDp_00065) 34717..35295 - 579 WP_241389923 hypothetical protein -
MOO76_RS00190 (12newDp_00064) 35292..37586 - 2295 WP_261166663 DotA/TraY family protein -
MOO76_RS00195 (12newDp_00063) 37501..38064 - 564 WP_241389924 conjugal transfer protein TraX -
MOO76_RS00200 (12newDp_00062) 38057..39283 - 1227 WP_241389925 conjugal transfer protein TraW traW
MOO76_RS00205 (12newDp_00060) 39424..42498 - 3075 WP_241389926 type IV secretory system conjugative DNA transfer family protein traU
MOO76_RS00210 (12newDp_00059) 42501..43106 - 606 WP_241389927 hypothetical protein traT
MOO76_RS00215 (12newDp_00058) 43193..43594 - 402 WP_241389604 DUF6750 family protein traR
MOO76_RS00220 (12newDp_00057) 43610..44140 - 531 WP_241389877 conjugal transfer protein TraQ traQ
MOO76_RS00225 (12newDp_00056) 44149..44892 - 744 WP_241389928 hypothetical protein traP
MOO76_RS00230 (12newDp_00055) 44892..46124 - 1233 WP_241389929 conjugal transfer protein TraO traO
MOO76_RS00235 (12newDp_00054) 46128..47135 - 1008 WP_241389930 DotH/IcmK family type IV secretion protein traN
MOO76_RS00240 (12newDp_00053) 47138..47824 - 687 WP_241389609 DotI/IcmL/TraM family protein traM
MOO76_RS00245 (12newDp_00052) 47903..48394 - 492 WP_010895743 hypothetical protein traL
MOO76_RS00250 (12newDp_00051) 48404..51640 - 3237 WP_241389931 LPD7 domain-containing protein -
MOO76_RS00255 (12newDp_00049) 51783..52049 - 267 WP_241389932 IcmT/TraK family protein traK
MOO76_RS00260 (12newDp_00048) 52049..53206 - 1158 WP_241389933 plasmid transfer ATPase TraJ virB11
MOO76_RS00265 (12newDp_00046) 53396..54184 - 789 WP_010895747 type IV secretory system conjugative DNA transfer family protein traI
MOO76_RS00270 (12newDp_00045) 54181..54639 - 459 WP_010895748 DotD/TraH family lipoprotein -
MOO76_RS00275 (12newDp_00044) 54677..56110 - 1434 WP_010895749 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MOO76_RS00280 (12newDp_00043) 56107..56775 - 669 WP_241389885 prepilin peptidase -
MOO76_RS00285 (12newDp_00042) 56775..57260 - 486 WP_241389886 lytic transglycosylase domain-containing protein virB1
MOO76_RS00290 (12newDp_00041) 57315..57908 - 594 WP_010895752 type 4 pilus major pilin -
MOO76_RS00295 (12newDp_00040) 57944..59056 - 1113 WP_241389887 type II secretion system F family protein -
MOO76_RS00300 (12newDp_00039) 59056..60546 - 1491 WP_241389888 ATPase, T2SS/T4P/T4SS family virB11
MOO76_RS00305 (12newDp_00038) 60552..61136 - 585 WP_241389889 type IV pilus biogenesis protein PilP -
MOO76_RS00310 (12newDp_00037) 61123..62433 - 1311 WP_241389890 type 4b pilus protein PilO2 -
MOO76_RS00315 (12newDp_00036) 62437..64071 - 1635 WP_241389891 PilN family type IVB pilus formation outer membrane protein -
MOO76_RS00320 (12newDp_00035) 64093..64518 - 426 WP_241389892 type IV pilus biogenesis protein PilM -
MOO76_RS00325 (12newDp_00034) 64518..65531 - 1014 WP_241389893 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   3888 GenBank   NZ_MT039176
Plasmid name   AGR_12newD|unnamed1 Incompatibility group   -
Plasmid size   104290 bp Coordinate of oriT [Strand]   21390..21471 [+]
Host baterium   Serratia proteamaculans strain AGR_12newD

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -