Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103415
Name   oriT_phvKpST395_2024 in_silico
Organism   Klebsiella pneumoniae subsp. pneumoniae strain 2024_Kpn
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MW911667 (39851..39949 [-], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_phvKpST395_2024
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2333 GenBank   WP_058842865
Name   traD_K5E81_RS00710_phvKpST395_2024 insolico UniProt ID   _
Length   708 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 708 a.a.        Molecular weight: 79556.01 Da        Isoelectric Point: 8.4986

>WP_058842865.1 MULTISPECIES: conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MKRRSRNNLHTQEMLYRPALEFRSALILILFSAYVLIDSWTSKYGISEIPFYCSLGLIAMAGWRVWHGVP
VFIAHWRLFHRTMDFLSLEDFRMINNAHFFADDRKYQKLVSLQESGGAPSKKSFYQLLRKKEKIVIPQRT
TFLCNGFKWGPEHSERTYQVHNLSSDMHEVQLPFILNPVTRHYRKLAFDLGGNYAIFGVDKKIPIFVNEE
NFFGHTLITGNVGTGKTVLQRLLSSSMLHLGHIVLVVDPKNDYQWQEGLKEECESLGKPFMHFHAGNPST
SVSYDVSANYVKDTDLSARIMSIISGTEGGEDPFVRIAEGLVTTAIGALKLGGTKPTIQNIYYAIRSKQD
LIVTTRNALRGFYTYHLGADWHLTVQVSPNLTFADEIEKLKEYFHCNYFEDNSPKNMHGMDTVLECFKYI
SGDESHYYKITASLMPMLKRLSQTPMDILLSANDVENPDRNIVNSHGLFNSGGVLYISLDGLSDPATARD
LSQLITSDIAAEAGSRYNTASDLSTVPRISIFIDEAHQAVNMQLINLLAQGRAAKIALFISTQTISDFVS
ATSADTADRLTGLCNNYISTRVTDAKTQELVLTKVGQTNVSMNQVTYTTSAGTKQSHTDFNGSISERKST
TMVNAIPQELLSMIPTLHFIACLQDGRKIVGQMPITVPGKSMRRSTTVFDMVTTSPYKLKMRRNLNVEEI
LSKSQKVG

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(473-655)

AAA-like domain (AAA_10)

(214-261)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 241632..265723

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K5E81_RS01370 237349..237774 - 426 WP_040120489 IS200/IS605 family transposase -
K5E81_RS01375 237811..239037 + 1227 WP_025368604 RNA-guided endonuclease TnpB family protein -
K5E81_RS01380 239103..240229 - 1127 Protein_277 conjugal transfer protein TraG N-terminal domain-containing protein -
K5E81_RS01385 240735..241583 + 849 WP_025368606 hypothetical protein -
K5E81_RS01390 241632..244817 - 3186 WP_040120490 conjugal transfer protein TraN traN
K5E81_RS01395 244827..245864 - 1038 WP_004026524 IncHI-type conjugal transfer protein TrhU traU
K5E81_RS01400 245861..247222 - 1362 WP_004026523 TrbC family F-type conjugative pilus assembly protein traW
K5E81_RS01405 247209..247733 - 525 WP_025368608 signal peptidase I -
K5E81_RS01410 247871..252112 - 4242 WP_004181790 Ig-like domain-containing protein -
K5E81_RS01415 252240..252776 - 537 WP_004181791 hypothetical protein -
K5E81_RS01420 252764..253168 - 405 WP_004181792 hypothetical protein -
K5E81_RS01425 253143..253601 - 459 WP_004196672 hypothetical protein -
K5E81_RS01430 254285..255088 + 804 WP_117089964 metallophosphoesterase -
K5E81_RS01435 255066..255794 + 729 WP_228289489 hypothetical protein -
K5E81_RS01440 255781..256281 + 501 WP_004181795 hypothetical protein -
K5E81_RS01445 256256..256669 + 414 WP_004196636 hypothetical protein -
K5E81_RS01450 256696..259413 - 2718 WP_058842879 TraC family protein virb4
K5E81_RS01455 259458..260195 - 738 WP_024198099 TraV family lipoprotein traV
K5E81_RS01460 260205..261056 - 852 WP_046664126 disulfide isomerase -
K5E81_RS01465 261059..261523 - 465 WP_004883002 membrane protein -
K5E81_RS01470 261526..262896 - 1371 WP_004181800 TrbI/VirB10 family protein traB
K5E81_RS01475 262856..263374 - 519 WP_004181801 hypothetical protein -
K5E81_RS01480 263371..264540 - 1170 WP_004026506 type-F conjugative transfer system secretin TraK traK
K5E81_RS01485 264542..265402 - 861 WP_004181802 TraE/TraK family type IV conjugative transfer system protein traE
K5E81_RS01490 265421..265723 - 303 WP_024198097 type IV conjugative transfer system protein TraL traL
K5E81_RS01495 265825..266193 - 369 WP_004026504 hypothetical protein -
K5E81_RS01500 266346..266558 + 213 WP_064116235 hypothetical protein -
K5E81_RS01505 267468..268136 + 669 WP_071557837 hypothetical protein -
K5E81_RS01510 268192..268956 + 765 WP_004196640 hypothetical protein -
K5E81_RS01515 269084..270262 + 1179 WP_004196657 hypothetical protein -

Host bacterium

ID   3858 GenBank   NZ_MW911667
Plasmid name   phvKpST395_2024 Incompatibility group   IncFIB
Plasmid size   315877 bp Coordinate of oriT [Strand]   39851..39949 [-]
Host baterium   Klebsiella pneumoniae subsp. pneumoniae strain 2024_Kpn

Cargo genes

Drug resistance gene   tet(A), dfrA1, qacE, sul1, aac(6')-Ib-cr, blaOXA-1, catA1, blaCTX-M-15, blaTEM-1B, qnrS1
Virulence gene   rmpA
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -