Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103401
Name   oriT_pSZ10R-tetX4 in_silico
Organism   Escherichia sp. strain SZ10R
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MW940628 (2912..3005 [+], 94 nt)
oriT length   94 nt
IRs (inverted repeats)      72..77, 84..89  (AAAAAA..TTTTTT)
 72..77, 83..88  (AAAAAA..TTTTTT)
 26..33, 36..43  (AGCGTGAT..ATCACGCT)
 12..18, 30..36  (TAAATCA..TGATTTA)
Location of nic site      54..55
Conserved sequence flanking the
  nic site  
 
 GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 94 nt

>oriT_pSZ10R-tetX4
TTTTTTTCTTTTAAATCAGTGAGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTAACGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   2538 GenBank   WP_223820406
Name   Mob_Pre_KSF49_RS00180_pSZ10R-tetX4 insolico UniProt ID   _
Length   103 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 103 a.a.        Molecular weight: 11864.27 Da        Isoelectric Point: 7.7517

>WP_223820406.1 MULTISPECIES: plasmid recombination protein [Gammaproteobacteria]
MGTVAAALQHCYRDRETPNADQERTPDNDHLAARSTDEAMGKLRERLPEKRRKDAVLAVEYVMSASPEWW
QTASADQQREFFKRSTEWLAACRKFRCSATAMN

  Protein domains


Predicted by InterproScan.

(4-90)


  Protein structure



No available structure.




Host bacterium


ID   3844 GenBank   NZ_MW940628
Plasmid name   pSZ10R-tetX4 Incompatibility group   IncFIB
Plasmid size   130185 bp Coordinate of oriT [Strand]   2912..3005 [+]
Host baterium   Escherichia sp. strain SZ10R

Cargo genes


Drug resistance gene   erm(42), tet(X4), floR, mph(A), blaTEM-1B, tet(M), tet(A), dfrA12, aadA2, cmlA1, ant(3'')-Ia, sul3, aph(3'')-Ib, aph(6)-Id
Virulence gene   -
Metal resistance gene   silP, silA, silB, silF, silC, silR, silS, silE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -