Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103396
Name   oriT_phvKpST15_NDM-1_2501 in_silico
Organism   Klebsiella pneumoniae subsp. pneumoniae strain 2501_kpn
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MW911669 (170311..170338 [+], 28 nt)
oriT length   28 nt
IRs (inverted repeats)      16..21, 23..28  (ATCAGA..TCTGAT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 28 nt

>oriT_phvKpST15_NDM-1_2501
AGTTTGGTGCTTATGATCAGAATCTGAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2314 GenBank   WP_058842865
Name   traD_K5E85_RS00320_phvKpST15_NDM-1_2501 insolico UniProt ID   _
Length   708 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 708 a.a.        Molecular weight: 79556.01 Da        Isoelectric Point: 8.4986

>WP_058842865.1 MULTISPECIES: conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MKRRSRNNLHTQEMLYRPALEFRSALILILFSAYVLIDSWTSKYGISEIPFYCSLGLIAMAGWRVWHGVP
VFIAHWRLFHRTMDFLSLEDFRMINNAHFFADDRKYQKLVSLQESGGAPSKKSFYQLLRKKEKIVIPQRT
TFLCNGFKWGPEHSERTYQVHNLSSDMHEVQLPFILNPVTRHYRKLAFDLGGNYAIFGVDKKIPIFVNEE
NFFGHTLITGNVGTGKTVLQRLLSSSMLHLGHIVLVVDPKNDYQWQEGLKEECESLGKPFMHFHAGNPST
SVSYDVSANYVKDTDLSARIMSIISGTEGGEDPFVRIAEGLVTTAIGALKLGGTKPTIQNIYYAIRSKQD
LIVTTRNALRGFYTYHLGADWHLTVQVSPNLTFADEIEKLKEYFHCNYFEDNSPKNMHGMDTVLECFKYI
SGDESHYYKITASLMPMLKRLSQTPMDILLSANDVENPDRNIVNSHGLFNSGGVLYISLDGLSDPATARD
LSQLITSDIAAEAGSRYNTASDLSTVPRISIFIDEAHQAVNMQLINLLAQGRAAKIALFISTQTISDFVS
ATSADTADRLTGLCNNYISTRVTDAKTQELVLTKVGQTNVSMNQVTYTTSAGTKQSHTDFNGSISERKST
TMVNAIPQELLSMIPTLHFIACLQDGRKIVGQMPITVPGKSMRRSTTVFDMVTTSPYKLKMRRNLNVEEI
LSKSQKVG

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(473-655)

AAA-like domain (AAA_10)

(214-261)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 244135..268226

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K5E85_RS01345 239852..240277 - 426 WP_040120489 IS200/IS605 family transposase -
K5E85_RS01350 240314..241540 + 1227 WP_025368604 RNA-guided endonuclease TnpB family protein -
K5E85_RS01355 241606..242732 - 1127 Protein_276 conjugal transfer protein TraG N-terminal domain-containing protein -
K5E85_RS01360 243238..244086 + 849 WP_025368606 hypothetical protein -
K5E85_RS01365 244135..247320 - 3186 WP_040120490 conjugal transfer protein TraN traN
K5E85_RS01370 247330..248367 - 1038 WP_004026524 IncHI-type conjugal transfer protein TrhU traU
K5E85_RS01375 248364..249725 - 1362 WP_004026523 TrbC family F-type conjugative pilus assembly protein traW
K5E85_RS01380 249712..250236 - 525 WP_025368608 signal peptidase I -
K5E85_RS01385 250374..254615 - 4242 WP_004181790 Ig-like domain-containing protein -
K5E85_RS01390 254743..255279 - 537 WP_004181791 hypothetical protein -
K5E85_RS01395 255267..255665 - 399 WP_210253559 hypothetical protein -
K5E85_RS01400 255646..256104 - 459 WP_004196672 hypothetical protein -
K5E85_RS01405 256788..257591 + 804 WP_117089964 metallophosphoesterase -
K5E85_RS01410 257581..258297 + 717 WP_004181794 hypothetical protein -
K5E85_RS01415 258284..258784 + 501 WP_004181795 hypothetical protein -
K5E85_RS01420 258759..259172 + 414 WP_004196636 hypothetical protein -
K5E85_RS01425 259199..261916 - 2718 WP_058842879 TraC family protein virb4
K5E85_RS01430 261961..262698 - 738 WP_024198099 TraV family lipoprotein traV
K5E85_RS01435 262708..263559 - 852 WP_046664126 disulfide isomerase -
K5E85_RS01440 263562..264026 - 465 WP_004883002 membrane protein -
K5E85_RS01445 264029..265399 - 1371 WP_004181800 TrbI/VirB10 family protein traB
K5E85_RS01450 265359..265877 - 519 WP_004181801 hypothetical protein -
K5E85_RS01455 265874..267043 - 1170 WP_004026506 type-F conjugative transfer system secretin TraK traK
K5E85_RS01460 267045..267905 - 861 WP_004181802 TraE/TraK family type IV conjugative transfer system protein traE
K5E85_RS01465 267924..268226 - 303 WP_024198097 type IV conjugative transfer system protein TraL traL
K5E85_RS01470 268328..268696 - 369 WP_004026504 hypothetical protein -
K5E85_RS01475 269971..270639 + 669 WP_071557837 hypothetical protein -
K5E85_RS01480 270695..271459 + 765 WP_004196640 hypothetical protein -
K5E85_RS01485 271587..272765 + 1179 WP_004196657 hypothetical protein -

Host bacterium

ID   3839 GenBank   NZ_MW911669
Plasmid name   phvKpST15_NDM-1_2501 Incompatibility group   IncFIB
Plasmid size   317603 bp Coordinate of oriT [Strand]   170311..170338 [+]
Host baterium   Klebsiella pneumoniae subsp. pneumoniae strain 2501_kpn

Cargo genes

Drug resistance gene   blaNDM-1, aph(3')-VI, qnrS1, mph(E), msr(E), armA, sul2
Virulence gene   rmpA, iucA, iucB, iucC, iutA
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -