Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103395
Name   oriT_pLYS105A-1 in_silico
Organism   Klebsiella pneumoniae strain LYS105A
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MW581615 (149974..150097 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_pLYS105A-1
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTTTTTGAATCATTAGCTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   1095 GenBank   WP_001254386
Name   WP_001254386_pLYS105A-1 insolico UniProt ID   A0A3Z6KJB5
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9005.11 Da        Isoelectric Point: 10.1422

>WP_001254386.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Gammaproteobacteria]
MRRRNARGGISRTVSVYLDEDTNNRLIKAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVTEESES
TFKEL

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(14-61)


  Protein structure


Source ID Structure
AlphaFold DB A0A3Z6KJB5

ID   1096 GenBank   WP_000124981
Name   WP_000124981_pLYS105A-1 insolico UniProt ID   A0A630FTW9
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14542.59 Da        Isoelectric Point: 5.0278

>WP_000124981.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MARVNLYISNEVHEKINMIVEKRRQEGARDKDISLSGTASMLLELGLRVYDAQMERKESAFNQTEFNKLL
LECVVKTQSTVAKILGIESLSPHVSGNPKFEYASMVDDIREKVSVEMDRFFPKNDDE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A630FTW9


T4CP

ID   2313 GenBank   WP_072652432
Name   traC_KC526_RS00700_pLYS105A-1 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99282.99 Da        Isoelectric Point: 6.0801

>WP_072652432.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKNKARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraG P-loop domain (P-loop_TraG)

(467-771)

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 125975..150669

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KC526_RS00600 122147..122893 + 747 WP_001016257 IS21-like element ISEc12 family helper ATPase IstB -
KC526_RS00605 122978..124471 - 1494 Protein_123 type IV conjugative transfer system coupling protein TraD -
KC526_RS00610 124724..125455 - 732 WP_000850416 conjugal transfer complement resistance protein TraT -
KC526_RS00615 125469..125978 - 510 WP_000628105 conjugal transfer entry exclusion protein TraS -
KC526_RS00620 125975..128800 - 2826 WP_072652426 conjugal transfer mating-pair stabilization protein TraG traG
KC526_RS00625 128797..130170 - 1374 WP_000944319 conjugal transfer pilus assembly protein TraH traH
KC526_RS00630 130157..130549 - 393 Protein_128 F-type conjugal transfer protein TrbF -
KC526_RS00635 130536..130877 - 342 WP_001442101 P-type conjugative transfer protein TrbJ -
KC526_RS00640 130807..131352 - 546 WP_000059833 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
KC526_RS00645 131339..131623 - 285 WP_000624108 type-F conjugative transfer system pilin chaperone TraQ -
KC526_RS00650 131704..131979 + 276 WP_001513501 hypothetical protein -
KC526_RS00655 132043..132848 + 806 WP_170854765 IS5 family transposase -
KC526_RS00660 132853..133200 - 348 WP_001287907 conjugal transfer protein TrbA -
KC526_RS00665 133216..133965 - 750 WP_001331259 type-F conjugative transfer system pilin assembly protein TraF traF
KC526_RS00670 133952..134209 - 258 WP_000864318 conjugal transfer protein TrbE -
KC526_RS00675 134236..136044 - 1809 WP_072645770 type-F conjugative transfer system mating-pair stabilization protein TraN traN
KC526_RS00680 136041..136679 - 639 WP_000777703 type-F conjugative transfer system pilin assembly protein TrbC trbC
KC526_RS00685 136688..137680 - 993 WP_000830183 conjugal transfer pilus assembly protein TraU traU
KC526_RS00690 137677..138309 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
KC526_RS00695 138306..138692 - 387 WP_000099688 type-F conjugative transfer system protein TrbI -
KC526_RS00700 138689..141316 - 2628 WP_072652432 type IV secretion system protein TraC virb4
KC526_RS00705 141476..141697 - 222 WP_001278690 conjugal transfer protein TraR -
KC526_RS00710 141832..142347 - 516 WP_000809834 type IV conjugative transfer system lipoprotein TraV traV
KC526_RS00715 142344..142595 - 252 WP_001038351 conjugal transfer protein TrbG -
KC526_RS00720 142607..142804 - 198 WP_001324648 conjugal transfer protein TrbD -
KC526_RS00725 142791..143381 - 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
KC526_RS00730 143371..144798 - 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
KC526_RS00735 144798..145526 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
KC526_RS00740 145513..146079 - 567 WP_000399774 type IV conjugative transfer system protein TraE traE
KC526_RS00745 146101..146412 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
KC526_RS00750 146427..146714 - 288 Protein_152 type IV conjugative transfer system pilin TraA -
KC526_RS00755 146818..148026 + 1209 WP_001352368 IS4-like element ISVsa5 family transposase -
KC526_RS00760 148041..148130 - 90 Protein_154 type IV conjugative transfer system pilin TraA -
KC526_RS00765 148164..148391 - 228 WP_001254386 conjugal transfer relaxosome protein TraY -
KC526_RS00770 148485..149171 - 687 WP_001825184 PAS domain-containing protein -
KC526_RS00775 149362..149745 - 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
KC526_RS00780 150022..150669 + 648 WP_001825185 transglycosylase SLT domain-containing protein virB1
KC526_RS00785 150966..151787 - 822 WP_001234469 DUF932 domain-containing protein -
KC526_RS01080 151905..152192 - 288 WP_000107544 hypothetical protein -
KC526_RS01085 152194..152515 + 322 Protein_161 hypothetical protein -
KC526_RS00795 152816..152938 - 123 WP_223195199 Hok/Gef family protein -
KC526_RS01090 152883..153035 - 153 Protein_163 DUF5431 family protein -
KC526_RS00800 153252..153971 - 720 WP_001276275 plasmid SOS inhibition protein A -
KC526_RS00805 153968..154402 - 435 WP_000845935 conjugation system SOS inhibitor PsiB -

Host bacterium

ID   3838 GenBank   NZ_MW581615
Plasmid name   pLYS105A-1 Incompatibility group   IncFIB
Plasmid size   199940 bp Coordinate of oriT [Strand]   149974..150097 [-]
Host baterium   Klebsiella pneumoniae strain LYS105A

Cargo genes

Drug resistance gene   sitABCD
Virulence gene   iroB, iroC, iroD, iroE, iroN, vat, iutA, iucC, iucB, iucA
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -