Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103351
Name   oriT_pESBL57 in_silico
Organism   Escherichia coli strain E. coli UB-ESBL57
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT230318 (2710..2795 [-], 86 nt)
oriT length   86 nt
IRs (inverted repeats)      61..68, 73..80  (TTGGTGGT..ACCACCAA)
 27..34, 37..44  (GCAAAAAC..GTTTTTGC)
 8..14, 20..26  (TGATTTA..TAAATCA)
Location of nic site      53..54
Conserved sequence flanking the
  nic site    		  TGTGTGGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_pESBL57
AATTACATGATTTAAAACGTAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2282 GenBank   WP_012917677
Name   traC_G6847_RS00100_pESBL57 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99204.83 Da        Isoelectric Point: 6.0793

>WP_012917677.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILRQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraG P-loop domain (P-loop_TraG)

(469-764)

Family of unknown function (DUF5934) (DUF5934)

(290-447)

TraC protein (TraC_F_IV)

(39-277)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 2142..26145

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G6847_RS00205 146..319 - 174 Protein_0 hypothetical protein -
G6847_RS00005 (G6847_00001) 619..915 + 297 WP_001272251 hypothetical protein -
G6847_RS00010 (G6847_00002) 1025..1846 + 822 WP_001234437 DUF932 domain-containing protein -
G6847_RS00015 (G6847_00003) 2142..2744 - 603 WP_000243715 transglycosylase SLT domain-containing protein virB1
G6847_RS00020 (G6847_00004) 3066..3449 + 384 WP_001354030 conjugal transfer relaxosome DNA-binding protein TraM -
G6847_RS00025 (G6847_00005) 3643..4314 + 672 WP_000283561 conjugal transfer transcriptional regulator TraJ -
G6847_RS00030 4451..4678 + 228 WP_000089263 conjugal transfer relaxosome protein TraY -
G6847_RS00035 (G6847_00006) 4711..5073 + 363 WP_171868824 type IV conjugative transfer system pilin TraA -
G6847_RS00040 (G6847_00007) 5078..5389 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
G6847_RS00045 (G6847_00008) 5411..5977 + 567 WP_000399801 type IV conjugative transfer system protein TraE traE
G6847_RS00050 (G6847_00009) 5964..6692 + 729 WP_001230772 type-F conjugative transfer system secretin TraK traK
G6847_RS00055 (G6847_00010) 6692..8143 + 1452 WP_000146675 F-type conjugal transfer pilus assembly protein TraB traB
G6847_RS00060 8133..8698 + 566 Protein_12 conjugal transfer pilus-stabilizing protein TraP -
G6847_RS00065 (G6847_00013) 8685..9005 + 321 WP_001057307 conjugal transfer protein TrbD -
G6847_RS00070 (G6847_00014) 9002..9517 + 516 WP_000809881 type IV conjugative transfer system lipoprotein TraV traV
G6847_RS00075 9652..9873 + 222 WP_001278683 conjugal transfer protein TraR -
G6847_RS00080 (G6847_00015) 9866..10279 + 414 WP_000549589 hypothetical protein -
G6847_RS00085 (G6847_00016) 10272..10745 + 474 WP_000549568 hypothetical protein -
G6847_RS00090 (G6847_00017) 10825..11043 + 219 WP_000556745 hypothetical protein -
G6847_RS00095 (G6847_00018) 11071..11418 + 348 WP_000836682 hypothetical protein -
G6847_RS00100 (G6847_00019) 11544..14174 + 2631 WP_012917677 type IV secretion system protein TraC virb4
G6847_RS00105 (G6847_00020) 14171..14557 + 387 WP_000214084 type-F conjugative transfer system protein TrbI -
G6847_RS00110 (G6847_00021) 14554..15186 + 633 WP_001203728 type-F conjugative transfer system protein TraW traW
G6847_RS00115 (G6847_00022) 15183..16175 + 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
G6847_RS00120 (G6847_00023) 16205..16510 + 306 WP_000224416 hypothetical protein -
G6847_RS00125 (G6847_00024) 16519..17157 + 639 WP_001080256 type-F conjugative transfer system pilin assembly protein TrbC trbC
G6847_RS00130 (G6847_00025) 17154..19004 + 1851 WP_000821856 type-F conjugative transfer system mating-pair stabilization protein TraN traN
G6847_RS00135 (G6847_00026) 19031..19288 + 258 WP_000864353 conjugal transfer protein TrbE -
G6847_RS00140 (G6847_00027) 19281..20024 + 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
G6847_RS00145 (G6847_00028) 20038..20382 + 345 WP_000556796 conjugal transfer protein TrbA -
G6847_RS00150 (G6847_00029) 20501..20785 + 285 WP_000624194 type-F conjugative transfer system pilin chaperone TraQ -
G6847_RS00155 20772..21316 + 545 Protein_31 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB -
G6847_RS00160 21246..21593 + 348 WP_001309242 P-type conjugative transfer protein TrbJ -
G6847_RS00165 (G6847_00032) 21574..21966 + 393 WP_000660699 F-type conjugal transfer protein TrbF -
G6847_RS00170 (G6847_00033) 21953..23326 + 1374 WP_000944331 conjugal transfer pilus assembly protein TraH traH
G6847_RS00175 (G6847_00034) 23323..26145 + 2823 WP_096941503 conjugal transfer mating-pair stabilization protein TraG traG
G6847_RS00180 (G6847_00035) 26161..26646 + 486 WP_000605870 hypothetical protein -
G6847_RS00185 (G6847_00036) 26695..27426 + 732 WP_000782451 conjugal transfer complement resistance protein TraT -
G6847_RS00190 (G6847_00037) 27629..28366 + 738 WP_000199905 hypothetical protein -
G6847_RS00195 28417..30623 + 2207 Protein_39 type IV conjugative transfer system coupling protein TraD -

Host bacterium

ID   3794 GenBank   NZ_MT230318
Plasmid name   pESBL57 Incompatibility group   -
Plasmid size   32622 bp Coordinate of oriT [Strand]   2710..2795 [-]
Host baterium   Escherichia coli strain E. coli UB-ESBL57

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -