Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103313 |
| Name | oriT_pEC1188-MCR |
| Organism | Escherichia coli strain EC1188 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_MH213346 (18676..18728 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pEC1188-MCR
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2257 | GenBank | WP_015059539 |
| Name | t4cp2_HTR71_RS00270_pEC1188-MCR |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 37557..61013
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTR71_RS00210 | 33078..34202 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HTR71_RS00215 | 35016..35294 | - | 279 | WP_172693542 | pilus assembly protein | - |
| HTR71_RS00430 | 35297..35537 | + | 241 | Protein_46 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTR71_RS00220 | 35724..36905 | - | 1182 | WP_236918774 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTR71_RS00225 | 36918..37553 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HTR71_RS00230 | 37557..38039 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTR71_RS00235 | 38105..38662 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HTR71_RS00240 | 38707..39816 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTR71_RS00245 | 39807..41345 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTR71_RS00250 | 41370..41864 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTR71_RS00255 | 41848..43170 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTR71_RS00260 | 43209..44852 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTR71_RS00265 | 44845..45381 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HTR71_RS00270 | 45428..47386 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTR71_RS00275 | 47402..48457 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTR71_RS00280 | 48476..49615 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| HTR71_RS00285 | 49605..50306 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTR71_RS00290 | 50372..51106 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTR71_RS00295 | 51272..53628 | - | 2357 | Protein_62 | conjugal transfer protein | - |
| HTR71_RS00300 | 53634..53954 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTR71_RS00435 | 54025..54315 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTR71_RS00310 | 54315..54899 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HTR71_RS00315 | 54920..55318 | - | 399 | WP_072643816 | hypothetical protein | - |
| HTR71_RS00320 | 55437..55874 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HTR71_RS00325 | 55880..57115 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HTR71_RS00330 | 57118..57417 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTR71_RS00335 | 57485..57766 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HTR71_RS00340 | 57756..58007 | - | 252 | WP_000121741 | hypothetical protein | - |
| HTR71_RS00345 | 58107..58742 | - | 636 | WP_015059536 | hypothetical protein | - |
| HTR71_RS00350 | 58815..59102 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
| HTR71_RS00355 | 59115..59369 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| HTR71_RS00360 | 59371..60012 | - | 642 | WP_001425343 | type IV secretion system protein | - |
| HTR71_RS00365 | 60018..61013 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| HTR71_RS00370 | 61017..61274 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTR71_RS00375 | 61553..61810 | - | 258 | WP_001542015 | hypothetical protein | - |
| HTR71_RS00380 | 61843..62289 | - | 447 | WP_001243165 | hypothetical protein | - |
| HTR71_RS00385 | 62300..62470 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTR71_RS00390 | 62474..62917 | - | 444 | WP_000964330 | NfeD family protein | - |
| HTR71_RS00395 | 63291..64244 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HTR71_RS00400 | 64440..64654 | - | 215 | Protein_83 | DUF1187 family protein | - |
| HTR71_RS00405 | 64647..65153 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3756 | GenBank | NZ_MH213346 |
| Plasmid name | pEC1188-MCR | Incompatibility group | IncI2 |
| Plasmid size | 65806 bp | Coordinate of oriT [Strand] | 18676..18728 [-] |
| Host baterium | Escherichia coli strain EC1188 |
Cargo genes
| Drug resistance gene | blaCTX-M-199, mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |