Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103306
Name   oriT_pG3216 in_silico
Organism   Escherichia coli strain 3216
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MF693349 (16505..16557 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pG3216
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2246 GenBank   WP_015059539
Name   t4cp2_HTO95_RS00330_pG3216 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(127-591)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 35136..59300

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTO95_RS00185 30225..30584 + 360 WP_172690246 hypothetical protein -
HTO95_RS00190 31228..31734 + 507 WP_039022938 CaiF/GrlA family transcriptional regulator -
HTO95_RS00195 31727..31942 + 216 WP_001127357 DUF1187 family protein -
HTO95_RS00200 31935..32111 + 177 WP_172692678 hypothetical protein -
HTO95_RS00205 32138..33091 + 954 WP_072109880 SPFH domain-containing protein -
HTO95_RS00210 33465..33908 + 444 WP_072037179 NfeD family protein -
HTO95_RS00215 33912..34082 + 171 WP_000550720 hypothetical protein -
HTO95_RS00220 34093..34305 + 213 WP_039022940 hypothetical protein -
HTO95_RS00225 34525..34878 + 354 WP_023154634 hypothetical protein -
HTO95_RS00230 34875..35132 + 258 WP_000739144 hypothetical protein -
HTO95_RS00235 35136..36131 + 996 WP_172690245 type IV secretion system protein virB6
HTO95_RS00240 36137..36781 + 645 WP_001310442 type IV secretion system protein -
HTO95_RS00245 36790..37014 + 225 WP_000713561 EexN family lipoprotein -
HTO95_RS00250 37269..38060 - 792 WP_022645137 DUF5710 domain-containing protein -
HTO95_RS00255 38108..38743 + 636 WP_015059536 hypothetical protein -
HTO95_RS00260 38843..39094 + 252 WP_000121741 hypothetical protein -
HTO95_RS00265 39084..39365 + 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
HTO95_RS00270 39433..39732 + 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
HTO95_RS00275 39735..40970 + 1236 WP_015059538 TcpQ domain-containing protein -
HTO95_RS00280 40976..41413 + 438 WP_000539665 type IV pilus biogenesis protein PilM -
HTO95_RS00285 41532..41930 + 399 WP_001153665 hypothetical protein -
HTO95_RS00290 41951..42535 + 585 WP_001177113 lytic transglycosylase domain-containing protein virB1
HTO95_RS00425 42535..42825 + 291 WP_000865479 conjugal transfer protein -
HTO95_RS00300 42896..43216 + 321 WP_000362080 VirB3 family type IV secretion system protein virB3
HTO95_RS00305 43222..45579 + 2358 WP_000548955 VirB4 family type IV secretion system protein virb4
HTO95_RS00310 45745..46479 + 735 WP_000432282 type IV secretion system protein virB8
HTO95_RS00315 46545..47246 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HTO95_RS00320 47236..48375 + 1140 WP_000790640 TrbI/VirB10 family protein virB10
HTO95_RS00325 48394..49449 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
HTO95_RS00330 49465..51423 + 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
HTO95_RS00335 51470..52012 + 543 WP_001220544 sigma 54-interacting transcriptional regulator virb4
HTO95_RS00340 52005..53648 + 1644 WP_001035591 PilN family type IVB pilus formation outer membrane protein -
HTO95_RS00345 53687..55009 + 1323 WP_000454142 type 4b pilus protein PilO2 -
HTO95_RS00350 54993..55487 + 495 WP_000912553 type IV pilus biogenesis protein PilP -
HTO95_RS00355 55512..57050 + 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HTO95_RS00360 57041..58150 + 1110 WP_000974903 type II secretion system F family protein -
HTO95_RS00365 58195..58752 + 558 WP_000095048 type 4 pilus major pilin -
HTO95_RS00370 58818..59300 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HTO95_RS00375 59304..59939 + 636 WP_000934977 A24 family peptidase -
HTO95_RS00380 59952..61238 + 1287 WP_172692680 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTO95_RS00385 61387..61791 - 405 WP_001175008 IS200/IS605 family transposase -
HTO95_RS00390 61850..62716 + 867 Protein_80 transposase -

Host bacterium

ID   3749 GenBank   NZ_MF693349
Plasmid name   pG3216 Incompatibility group   IncI2
Plasmid size   62717 bp Coordinate of oriT [Strand]   16505..16557 [+]
Host baterium   Escherichia coli strain 3216

Cargo genes

Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -