Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103305
Name   oriT_pKP91 in_silico
Organism   Klebsiella pneumoniae strain KP91
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MG736312 (10753..10802 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site  
 
 TGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pKP91
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2245 GenBank   WP_228303505
Name   traD_HTQ44_RS00455_pKP91 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 85885.99 Da        Isoelectric Point: 5.0596

>WP_228303505.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVIAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNI

  Protein domains


Predicted by InterproScan.

(32-128)

(172-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 79225..95796

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTQ44_RS00455 (pKP91-00092) 79225..81537 - 2313 WP_228303505 type IV conjugative transfer system coupling protein TraD virb4
HTQ44_RS00460 (pKP91-00093) 81664..82353 - 690 WP_172691968 hypothetical protein -
HTQ44_RS00465 (pKP91-00094) 82546..83277 - 732 WP_004152629 conjugal transfer complement resistance protein TraT -
HTQ44_RS00470 (pKP91-00095) 83466..83993 - 528 WP_040120388 conjugal transfer protein TraS -
HTQ44_RS00475 (pKP91-00096) 83999..86848 - 2850 WP_172691976 conjugal transfer mating-pair stabilization protein TraG traG
HTQ44_RS00480 86858..88217 - 1360 Protein_97 conjugal transfer pilus assembly protein TraH -
HTQ44_RS00485 (pKP91-00098) 88207..88653 - 447 WP_172691970 conjugal transfer protein TrbF -
HTQ44_RS00490 (pKP91-00099) 88700..89257 - 558 WP_172691971 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HTQ44_RS00495 (pKP91-00100) 89229..89468 - 240 WP_009309875 type-F conjugative transfer system pilin chaperone TraQ -
HTQ44_RS00500 (pKP91-00101) 89479..90231 - 753 WP_172691972 type-F conjugative transfer system pilin assembly protein TraF traF
HTQ44_RS00505 (pKP91-00102) 90252..90578 - 327 WP_016529362 hypothetical protein -
HTQ44_RS00570 (pKP91-00103) 90624..90809 - 186 WP_042922350 hypothetical protein -
HTQ44_RS00510 (pKP91-00104) 90806..91042 - 237 WP_114499720 conjugal transfer protein TrbE -
HTQ44_RS00515 (pKP91-00105) 91074..93029 - 1956 WP_172691973 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HTQ44_RS00520 (pKP91-00106) 93088..93726 - 639 WP_015065635 type-F conjugative transfer system pilin assembly protein TrbC trbC
HTQ44_RS00525 (pKP91-00107) 93739..94728 - 990 WP_032441886 conjugal transfer pilus assembly protein TraU traU
HTQ44_RS00530 (pKP91-00108) 94725..95126 - 402 WP_004194979 hypothetical protein -
HTQ44_RS00535 (pKP91-00109) 95161..95796 - 636 WP_020325113 type-F conjugative transfer system protein TraW traW


Host bacterium


ID   3748 GenBank   NZ_MG736312
Plasmid name   pKP91 Incompatibility group   IncFIA
Plasmid size   95983 bp Coordinate of oriT [Strand]   10753..10802 [+]
Host baterium   Klebsiella pneumoniae strain KP91

Cargo genes


Drug resistance gene   mcr-8
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -