Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103304 |
| Name | oriT_pPK105 |
| Organism | Escherichia coli strain PK105 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_MG808035 (13861..13913 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pPK105
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2244 | GenBank | WP_015059539 |
| Name | t4cp2_HTQ88_RS00235_pPK105 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 32487..55317
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTQ88_RS00165 | 27598..28251 | - | 654 | WP_170855322 | hypothetical protein | - |
| HTQ88_RS00170 | 28263..29387 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HTQ88_RS00175 | 29736..30065 | - | 330 | WP_106661584 | pilus assembly protein | - |
| HTQ88_RS00180 | 30383..30538 | + | 156 | WP_001358489 | hypothetical protein | - |
| HTQ88_RS00185 | 30765..31835 | - | 1071 | WP_172692532 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTQ88_RS00190 | 31848..32483 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HTQ88_RS00195 | 32487..32969 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTQ88_RS00200 | 33035..33598 | - | 564 | WP_034169414 | type 4 pilus major pilin | - |
| HTQ88_RS00205 | 33648..34757 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTQ88_RS00210 | 34748..36286 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTQ88_RS00215 | 36311..36805 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTQ88_RS00220 | 36789..38111 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTQ88_RS00225 | 38150..39793 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTQ88_RS00230 | 39786..40322 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HTQ88_RS00235 | 40369..42327 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTQ88_RS00240 | 42343..43398 | - | 1056 | WP_001542006 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTQ88_RS00245 | 43417..44556 | - | 1140 | WP_034169415 | TrbI/VirB10 family protein | virB10 |
| HTQ88_RS00250 | 44546..45247 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTQ88_RS00255 | 45313..46047 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTQ88_RS00260 | 46213..48570 | - | 2358 | WP_000548950 | VirB4 family type IV secretion system protein | virb4 |
| HTQ88_RS00265 | 48576..48896 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTQ88_RS00390 | 48967..49257 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTQ88_RS00275 | 49257..49841 | - | 585 | WP_001177117 | lytic transglycosylase domain-containing protein | virB1 |
| HTQ88_RS00280 | 49862..50260 | - | 399 | WP_001153669 | hypothetical protein | - |
| HTQ88_RS00285 | 50379..50816 | - | 438 | WP_034169416 | type IV pilus biogenesis protein PilM | - |
| HTQ88_RS00290 | 50822..52057 | - | 1236 | WP_034169417 | toxin co-regulated pilus biosynthesis Q family protein | - |
| HTQ88_RS00295 | 52060..52359 | - | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTQ88_RS00300 | 52407..53216 | + | 810 | WP_024237698 | DUF5710 domain-containing protein | - |
| HTQ88_RS00305 | 53439..53663 | - | 225 | WP_000713562 | EexN family lipoprotein | - |
| HTQ88_RS00310 | 53672..54316 | - | 645 | WP_001310442 | type IV secretion system protein | - |
| HTQ88_RS00315 | 54322..55317 | - | 996 | WP_001028540 | type IV secretion system protein | virB6 |
| HTQ88_RS00320 | 55321..55578 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTQ88_RS00325 | 55575..55928 | - | 354 | WP_223286767 | hypothetical protein | - |
| HTQ88_RS00330 | 56148..56594 | - | 447 | WP_001243165 | hypothetical protein | - |
| HTQ88_RS00335 | 56605..56775 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTQ88_RS00340 | 56779..57222 | - | 444 | WP_000964330 | NfeD family protein | - |
| HTQ88_RS00345 | 57596..58549 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HTQ88_RS00350 | 58576..58752 | - | 177 | WP_000753050 | hypothetical protein | - |
| HTQ88_RS00355 | 58745..58960 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HTQ88_RS00360 | 58953..59459 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3747 | GenBank | NZ_MG808035 |
| Plasmid name | pPK105 | Incompatibility group | - |
| Plasmid size | 60499 bp | Coordinate of oriT [Strand] | 13861..13913 [-] |
| Host baterium | Escherichia coli strain PK105 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |