Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103304
Name   oriT_pPK105 in_silico
Organism   Escherichia coli strain PK105
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MG808035 (13861..13913 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pPK105
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2244 GenBank   WP_015059539
Name   t4cp2_HTQ88_RS00235_pPK105 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(127-591)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 32487..55317

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTQ88_RS00165 27598..28251 - 654 WP_170855322 hypothetical protein -
HTQ88_RS00170 28263..29387 - 1125 WP_000486716 site-specific integrase -
HTQ88_RS00175 29736..30065 - 330 WP_106661584 pilus assembly protein -
HTQ88_RS00180 30383..30538 + 156 WP_001358489 hypothetical protein -
HTQ88_RS00185 30765..31835 - 1071 WP_172692532 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTQ88_RS00190 31848..32483 - 636 WP_000934977 A24 family peptidase -
HTQ88_RS00195 32487..32969 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HTQ88_RS00200 33035..33598 - 564 WP_034169414 type 4 pilus major pilin -
HTQ88_RS00205 33648..34757 - 1110 WP_000974903 type II secretion system F family protein -
HTQ88_RS00210 34748..36286 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HTQ88_RS00215 36311..36805 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
HTQ88_RS00220 36789..38111 - 1323 WP_000454142 type 4b pilus protein PilO2 -
HTQ88_RS00225 38150..39793 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
HTQ88_RS00230 39786..40322 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
HTQ88_RS00235 40369..42327 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
HTQ88_RS00240 42343..43398 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
HTQ88_RS00245 43417..44556 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
HTQ88_RS00250 44546..45247 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HTQ88_RS00255 45313..46047 - 735 WP_000432282 type IV secretion system protein virB8
HTQ88_RS00260 46213..48570 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
HTQ88_RS00265 48576..48896 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
HTQ88_RS00390 48967..49257 - 291 WP_000865479 conjugal transfer protein -
HTQ88_RS00275 49257..49841 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
HTQ88_RS00280 49862..50260 - 399 WP_001153669 hypothetical protein -
HTQ88_RS00285 50379..50816 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
HTQ88_RS00290 50822..52057 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
HTQ88_RS00295 52060..52359 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
HTQ88_RS00300 52407..53216 + 810 WP_024237698 DUF5710 domain-containing protein -
HTQ88_RS00305 53439..53663 - 225 WP_000713562 EexN family lipoprotein -
HTQ88_RS00310 53672..54316 - 645 WP_001310442 type IV secretion system protein -
HTQ88_RS00315 54322..55317 - 996 WP_001028540 type IV secretion system protein virB6
HTQ88_RS00320 55321..55578 - 258 WP_000739144 hypothetical protein -
HTQ88_RS00325 55575..55928 - 354 WP_223286767 hypothetical protein -
HTQ88_RS00330 56148..56594 - 447 WP_001243165 hypothetical protein -
HTQ88_RS00335 56605..56775 - 171 WP_000550720 hypothetical protein -
HTQ88_RS00340 56779..57222 - 444 WP_000964330 NfeD family protein -
HTQ88_RS00345 57596..58549 - 954 WP_072089442 SPFH domain-containing protein -
HTQ88_RS00350 58576..58752 - 177 WP_000753050 hypothetical protein -
HTQ88_RS00355 58745..58960 - 216 WP_001127357 DUF1187 family protein -
HTQ88_RS00360 58953..59459 - 507 WP_001326595 CaiF/GrlA family transcriptional regulator -

Host bacterium

ID   3747 GenBank   NZ_MG808035
Plasmid name   pPK105 Incompatibility group   -
Plasmid size   60499 bp Coordinate of oriT [Strand]   13861..13913 [-]
Host baterium   Escherichia coli strain PK105

Cargo genes

Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -