Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103301 |
| Name | oriT_pSC20141012  |
| Organism | Klebsiella pneumoniae strain SC20141012 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_MG267386 (17795..17847 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pSC20141012
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2241 | GenBank | WP_015059539 |
| Name | t4cp2_HTQ14_RS00275_pSC20141012 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 36947..60404
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTQ14_RS00205 (IS_e95f27d5_00041) | 32292..32824 | - | 533 | Protein_40 | thermonuclease family protein | - |
| HTQ14_RS00210 (IS_e95f27d5_00042) | 32854..33507 | - | 654 | WP_172691900 | hypothetical protein | - |
| HTQ14_RS00215 (IS_e95f27d5_00043) | 33519..34643 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HTQ14_RS00220 (IS_e95f27d5_00044) | 34692..35000 | + | 309 | WP_001199277 | hypothetical protein | - |
| HTQ14_RS00225 (IS_e95f27d5_00045) | 34979..36295 | - | 1317 | WP_021500066 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTQ14_RS00230 (IS_e95f27d5_00046) | 36308..36943 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HTQ14_RS00235 (IS_e95f27d5_00047) | 36947..37429 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTQ14_RS00240 (IS_e95f27d5_00048) | 37495..38052 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HTQ14_RS00245 (IS_e95f27d5_00049) | 38097..39206 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTQ14_RS00250 (IS_e95f27d5_00050) | 39197..40735 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTQ14_RS00255 (IS_e95f27d5_00051) | 40760..41254 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTQ14_RS00260 (IS_e95f27d5_00052) | 41238..42560 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTQ14_RS00265 (IS_e95f27d5_00053) | 42599..44242 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTQ14_RS00270 (IS_e95f27d5_00054) | 44235..44771 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HTQ14_RS00275 (IS_e95f27d5_00055) | 44818..46776 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTQ14_RS00280 (IS_e95f27d5_00056) | 46792..47847 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTQ14_RS00285 (IS_e95f27d5_00057) | 47866..49005 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| HTQ14_RS00290 (IS_e95f27d5_00058) | 48995..49696 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTQ14_RS00295 (IS_e95f27d5_00059) | 49762..50496 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTQ14_RS00300 (IS_e95f27d5_00061) | 50662..53019 | - | 2358 | WP_063078682 | VirB4 family type IV secretion system protein | virb4 |
| HTQ14_RS00305 (IS_e95f27d5_00062) | 53025..53345 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTQ14_RS00450 (IS_e95f27d5_00063) | 53416..53706 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTQ14_RS00315 (IS_e95f27d5_00064) | 53706..54290 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HTQ14_RS00320 (IS_e95f27d5_00065) | 54311..54709 | - | 399 | WP_001153665 | hypothetical protein | - |
| HTQ14_RS00325 (IS_e95f27d5_00066) | 54828..55265 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HTQ14_RS00330 (IS_e95f27d5_00067) | 55271..56506 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HTQ14_RS00335 (IS_e95f27d5_00068) | 56509..56808 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTQ14_RS00340 (IS_e95f27d5_00069) | 56876..57157 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HTQ14_RS00345 (IS_e95f27d5_00070) | 57147..57398 | - | 252 | WP_000121741 | hypothetical protein | - |
| HTQ14_RS00350 (IS_e95f27d5_00071) | 57498..58133 | - | 636 | WP_015059536 | hypothetical protein | - |
| HTQ14_RS00355 (IS_e95f27d5_00072) | 58206..58493 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
| HTQ14_RS00360 (IS_e95f27d5_00073) | 58506..58760 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| HTQ14_RS00365 (IS_e95f27d5_00074) | 58762..59403 | - | 642 | WP_001425343 | type IV secretion system protein | - |
| HTQ14_RS00370 (IS_e95f27d5_00075) | 59409..60404 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| HTQ14_RS00375 (IS_e95f27d5_00076) | 60408..60665 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTQ14_RS00380 (IS_e95f27d5_00077) | 60662..61015 | - | 354 | WP_223286767 | hypothetical protein | - |
| HTQ14_RS00385 (IS_e95f27d5_00079) | 61235..61681 | - | 447 | WP_001243165 | hypothetical protein | - |
| HTQ14_RS00390 (IS_e95f27d5_00080) | 61692..61862 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTQ14_RS00395 (IS_e95f27d5_00081) | 61866..62309 | - | 444 | WP_000964330 | NfeD family protein | - |
| HTQ14_RS00400 (IS_e95f27d5_00082) | 62683..63636 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HTQ14_RS00405 (IS_e95f27d5_00083) | 63663..63839 | - | 177 | WP_000753050 | hypothetical protein | - |
| HTQ14_RS00410 (IS_e95f27d5_00084) | 63832..64047 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HTQ14_RS00415 (IS_e95f27d5_00085) | 64040..64546 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3744 | GenBank | NZ_MG267386 |
| Plasmid name | pSC20141012 | Incompatibility group | IncI2 |
| Plasmid size | 65631 bp | Coordinate of oriT [Strand] | 17795..17847 [-] |
| Host baterium | Klebsiella pneumoniae strain SC20141012 |
Cargo genes
| Drug resistance gene | blaCTX-M-55, mcr-7.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |