Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103293
Name   oriT_p15095941 in_silico
Organism   Escherichia coli
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MK181563 (52802..52890 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_p15095941
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2461 GenBank   WP_024143648
Name   nikB_HTV92_RS00350_p15095941 insolico UniProt ID   A0A023JAU0
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104010.41 Da        Isoelectric Point: 7.4265

>WP_024143648.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNNDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB A0A023JAU0


Auxiliary protein

ID   1059 GenBank   WP_001283947
Name   WP_001283947_p15095941 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4CP

ID   2236 GenBank   WP_001289276
Name   trbC_HTV92_RS00355_p15095941 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86941.11 Da        Isoelectric Point: 6.7713

>WP_001289276.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 58268..99246

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTV92_RS00355 55984..58275 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
HTV92_RS00360 58268..59338 - 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
HTV92_RS00365 59357..60565 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
HTV92_RS00370 60857..61009 + 153 WP_001331364 Hok/Gef family protein -
HTV92_RS00375 61081..61332 - 252 WP_001291964 hypothetical protein -
HTV92_RS00645 61831..61926 + 96 WP_001303310 DinQ-like type I toxin DqlB -
HTV92_RS00380 61991..62275 - 285 WP_031942457 hypothetical protein -
HTV92_RS00385 62559..62768 + 210 WP_000062603 HEAT repeat domain-containing protein -
HTV92_RS00390 62840..63514 - 675 WP_236918815 plasmid IncI1-type surface exclusion protein ExcA -
HTV92_RS00395 63564..65732 - 2169 WP_021537350 DotA/TraY family protein traY
HTV92_RS00400 65829..66413 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
HTV92_RS00405 66442..67644 - 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
HTV92_RS00410 67611..68225 - 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
HTV92_RS00415 68225..71269 - 3045 WP_021265678 IncI1-type conjugal transfer protein TraU traU
HTV92_RS00420 71359..72159 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
HTV92_RS00425 72143..72331 - 189 WP_001277255 putative conjugal transfer protein TraS -
HTV92_RS00430 72395..72799 - 405 WP_000086958 IncI1-type conjugal transfer protein TraR traR
HTV92_RS00435 72850..73377 - 528 WP_001055569 conjugal transfer protein TraQ traQ
HTV92_RS00440 73377..74081 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
HTV92_RS00445 74081..75370 - 1290 WP_001272003 conjugal transfer protein TraO traO
HTV92_RS00450 75373..76356 - 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
HTV92_RS00455 76367..77059 - 693 WP_000138550 DotI/IcmL family type IV secretion protein traM
HTV92_RS00460 77056..77403 - 348 WP_001055900 conjugal transfer protein traL
HTV92_RS00465 77421..81188 - 3768 WP_001141527 LPD7 domain-containing protein -
HTV92_RS00470 81277..81828 - 552 WP_000014583 phospholipase D family protein -
HTV92_RS00475 81843..82133 - 291 WP_001299214 hypothetical protein traK
HTV92_RS00480 82130..83278 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
HTV92_RS00485 83275..84093 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
HTV92_RS00490 84090..84548 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
HTV92_RS00495 84943..85527 - 585 WP_000977522 histidine phosphatase family protein -
HTV92_RS00500 85587..86789 - 1203 WP_139501879 conjugal transfer protein TraF -
HTV92_RS00505 86874..87698 - 825 WP_001238939 conjugal transfer protein TraE traE
HTV92_RS00510 87849..89003 - 1155 WP_001139957 site-specific integrase -
HTV92_RS00515 89002..89319 + 318 WP_001558195 hypothetical protein -
HTV92_RS00520 89797..91059 + 1263 WP_000608644 IS1380-like element ISEcp1 family transposase -
HTV92_RS00525 91347..92222 + 876 WP_013188473 extended-spectrum class A beta-lactamase CTX-M-1 -
HTV92_RS00530 92269..92613 - 345 Protein_104 WbuC family cupin fold metalloprotein -
HTV92_RS00640 92613..92822 + 210 Protein_105 hypothetical protein -
HTV92_RS00665 93095..93319 + 225 Protein_106 hypothetical protein -
HTV92_RS00540 93316..94740 - 1425 WP_001389385 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTV92_RS00545 94740..95396 - 657 WP_001193553 prepilin peptidase -
HTV92_RS00550 95381..95941 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
HTV92_RS00555 95951..96565 - 615 WP_000959785 type 4 pilus major pilin -
HTV92_RS00560 96583..97680 - 1098 WP_001208805 type II secretion system F family protein -
HTV92_RS00565 97693..99246 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
HTV92_RS00570 99257..99709 - 453 WP_001247334 type IV pilus biogenesis protein PilP -
HTV92_RS00575 99696..100991 - 1296 WP_000752772 type 4b pilus protein PilO2 -
HTV92_RS00580 100984..102666 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
HTV92_RS00585 102680..103117 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
HTV92_RS00590 103117..104184 - 1068 WP_001302629 type IV pilus biogenesis lipoprotein PilL -

Host bacterium

ID   3736 GenBank   NZ_MK181563
Plasmid name   p15095941 Incompatibility group   IncI1
Plasmid size   109727 bp Coordinate of oriT [Strand]   52802..52890 [-]
Host baterium   Escherichia coli

Cargo genes

Drug resistance gene   dfrA17, aadA5, sul2, blaCTX-M-1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -