Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103290
Name   oriT_p15124679 in_silico
Organism   Escherichia coli
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MK181564 (51736..51824 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_p15124679
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2459 GenBank   WP_024143648
Name   nikB_HTV48_RS00345_p15124679 insolico UniProt ID   A0A023JAU0
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104010.41 Da        Isoelectric Point: 7.4265

>WP_024143648.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNNDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB A0A023JAU0


Auxiliary protein

ID   1057 GenBank   WP_001283947
Name   WP_001283947_p15124679 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4CP

ID   2233 GenBank   WP_001289276
Name   trbC_HTV48_RS00350_p15124679 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86941.11 Da        Isoelectric Point: 6.7713

>WP_001289276.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 57202..99245

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTV48_RS00350 54918..57209 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
HTV48_RS00355 57202..58272 - 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
HTV48_RS00360 58291..59499 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
HTV48_RS00365 59791..59943 + 153 WP_001331364 Hok/Gef family protein -
HTV48_RS00370 60015..60266 - 252 WP_001291964 hypothetical protein -
HTV48_RS00645 60765..60860 + 96 WP_001303310 DinQ-like type I toxin DqlB -
HTV48_RS00375 60925..61101 - 177 WP_001054904 hypothetical protein -
HTV48_RS00380 61493..61702 + 210 WP_000062603 HEAT repeat domain-containing protein -
HTV48_RS00385 61774..62448 - 675 WP_223866377 plasmid IncI1-type surface exclusion protein ExcA -
HTV48_RS00390 62498..64666 - 2169 WP_021537350 DotA/TraY family protein traY
HTV48_RS00395 64763..65347 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
HTV48_RS00400 65376..66578 - 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
HTV48_RS00405 66545..67159 - 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
HTV48_RS00410 67159..70203 - 3045 WP_021265678 IncI1-type conjugal transfer protein TraU traU
HTV48_RS00415 70293..71093 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
HTV48_RS00420 71077..71265 - 189 WP_001277255 putative conjugal transfer protein TraS -
HTV48_RS00425 71329..71733 - 405 WP_181365388 IncI1-type conjugal transfer protein TraR traR
HTV48_RS00430 71784..72311 - 528 WP_001055569 conjugal transfer protein TraQ traQ
HTV48_RS00435 72311..73015 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
HTV48_RS00440 73015..74304 - 1290 WP_001272003 conjugal transfer protein TraO traO
HTV48_RS00445 74307..75290 - 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
HTV48_RS00450 75301..75993 - 693 WP_000138550 DotI/IcmL family type IV secretion protein traM
HTV48_RS00455 75990..76337 - 348 WP_001055900 conjugal transfer protein traL
HTV48_RS00460 76355..80122 - 3768 WP_001141527 LPD7 domain-containing protein -
HTV48_RS00465 80211..80762 - 552 WP_000014583 phospholipase D family protein -
HTV48_RS00470 80777..81067 - 291 WP_001299214 hypothetical protein traK
HTV48_RS00475 81064..82212 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
HTV48_RS00480 82209..83027 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
HTV48_RS00485 83024..83482 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
HTV48_RS00490 83877..84461 - 585 WP_000977522 histidine phosphatase family protein -
HTV48_RS00495 84521..85723 - 1203 WP_000976351 conjugal transfer protein TraF -
HTV48_RS00500 85808..86632 - 825 WP_001238939 conjugal transfer protein TraE traE
HTV48_RS00505 86783..87937 - 1155 WP_001139957 site-specific integrase -
HTV48_RS00640 88255..88464 - 210 Protein_100 hypothetical protein -
HTV48_RS00510 88464..88808 + 345 Protein_101 WbuC family cupin fold metalloprotein -
HTV48_RS00515 88855..89730 - 876 WP_013188473 extended-spectrum class A beta-lactamase CTX-M-1 -
HTV48_RS00520 90018..90701 - 684 Protein_103 IS1380-like element ISEcp1 family transposase -
HTV48_RS00525 90735..91703 + 969 WP_000654811 IS5 family transposase -
HTV48_RS00530 91755..92345 - 591 Protein_105 IS1380-like element ISEcp1 family transposase -
HTV48_RS00660 93094..93318 + 225 Protein_106 hypothetical protein -
HTV48_RS00540 93315..94739 - 1425 WP_001389385 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTV48_RS00545 94739..95395 - 657 WP_001193553 prepilin peptidase -
HTV48_RS00550 95380..95940 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
HTV48_RS00555 95950..96564 - 615 WP_000959785 type 4 pilus major pilin -
HTV48_RS00560 96582..97679 - 1098 WP_001208805 type II secretion system F family protein -
HTV48_RS00565 97692..99245 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
HTV48_RS00570 99256..99708 - 453 WP_001247334 type IV pilus biogenesis protein PilP -
HTV48_RS00575 99695..100990 - 1296 WP_000752772 type 4b pilus protein PilO2 -
HTV48_RS00580 100983..102665 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
HTV48_RS00585 102679..103116 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
HTV48_RS00590 103116..104183 - 1068 WP_001302629 type IV pilus biogenesis lipoprotein PilL -

Host bacterium

ID   3733 GenBank   NZ_MK181564
Plasmid name   p15124679 Incompatibility group   IncI1
Plasmid size   109726 bp Coordinate of oriT [Strand]   51736..51824 [-]
Host baterium   Escherichia coli

Cargo genes

Drug resistance gene   aadA5, sul2, blaCTX-M-1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -