Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103269
Name   oriT_pESBL171 in_silico
Organism   Escherichia coli strain E. coli UB-ESBL171
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MT230153 (1031..1116 [-], 86 nt)
oriT length   86 nt
IRs (inverted repeats)      61..68, 73..80  (TTGGTGGT..ACCACCAA)
 27..34, 37..44  (GCAAAAAC..GTTTTTGC)
 8..14, 20..26  (TGATTTA..TAAATCA)
Location of nic site      53..54
Conserved sequence flanking the
  nic site    		  TGTGTGGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_pESBL171
AATTACATGATTTAAAACGTAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2212 GenBank   WP_012917677
Name   traC_G6849_RS00095_pESBL171 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99204.83 Da        Isoelectric Point: 6.0793

>WP_012917677.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILRQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraG P-loop domain (P-loop_TraG)

(469-764)

Family of unknown function (DUF5934) (DUF5934)

(290-447)

TraC protein (TraC_F_IV)

(39-277)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 463..18353

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G6849_RS00005 1..169 + 169 Protein_0 DUF945 domain-containing protein -
G6849_RS00010 (G6849_00023) 463..1065 - 603 WP_000243715 transglycosylase SLT domain-containing protein virB1
G6849_RS00015 (G6849_00024) 1387..1770 + 384 WP_001354030 conjugal transfer relaxosome DNA-binding protein TraM -
G6849_RS00020 (G6849_00025) 1964..2635 + 672 WP_000283561 conjugal transfer transcriptional regulator TraJ -
G6849_RS00025 2772..2999 + 228 WP_000089263 conjugal transfer relaxosome protein TraY -
G6849_RS00030 (G6849_00026) 3032..3391 + 360 WP_001098992 type IV conjugative transfer system pilin TraA -
G6849_RS00035 (G6849_00027) 3406..3717 + 312 WP_000012113 type IV conjugative transfer system protein TraL traL
G6849_RS00040 (G6849_00028) 3739..4305 + 567 WP_000399780 type IV conjugative transfer system protein TraE traE
G6849_RS00045 (G6849_00029) 4292..5020 + 729 WP_001230772 type-F conjugative transfer system secretin TraK traK
G6849_RS00050 (G6849_00030) 5020..6471 + 1452 WP_000146675 F-type conjugal transfer pilus assembly protein TraB traB
G6849_RS00055 (G6849_00031) 6461..7027 + 567 WP_000896599 conjugal transfer pilus-stabilizing protein TraP -
G6849_RS00060 (G6849_00032) 7014..7334 + 321 WP_001057307 conjugal transfer protein TrbD -
G6849_RS00065 (G6849_00033) 7331..7846 + 516 WP_000809881 type IV conjugative transfer system lipoprotein TraV traV
G6849_RS00070 7981..8202 + 222 WP_001278683 conjugal transfer protein TraR -
G6849_RS00075 (G6849_00034) 8195..8608 + 414 WP_000549589 hypothetical protein -
G6849_RS00080 (G6849_00035) 8601..9074 + 474 WP_000549568 hypothetical protein -
G6849_RS00085 (G6849_00036) 9154..9372 + 219 WP_000556745 hypothetical protein -
G6849_RS00090 (G6849_00037) 9400..9747 + 348 WP_000836682 hypothetical protein -
G6849_RS00095 (G6849_00038) 9873..12503 + 2631 WP_012917677 type IV secretion system protein TraC virb4
G6849_RS00100 (G6849_00039) 12500..12886 + 387 WP_000214084 type-F conjugative transfer system protein TrbI -
G6849_RS00105 (G6849_00040) 12883..13515 + 633 WP_001203728 type-F conjugative transfer system protein TraW traW
G6849_RS00110 (G6849_00041) 13512..14504 + 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
G6849_RS00115 (G6849_00042) 14534..14839 + 306 WP_000224416 hypothetical protein -
G6849_RS00120 (G6849_00043) 14848..15486 + 639 WP_001080256 type-F conjugative transfer system pilin assembly protein TrbC trbC
G6849_RS00125 (G6849_00044) 15483..17333 + 1851 WP_000821856 type-F conjugative transfer system mating-pair stabilization protein TraN traN
G6849_RS00130 (G6849_00045) 17360..17617 + 258 WP_000864353 conjugal transfer protein TrbE -
G6849_RS00135 (G6849_00046) 17610..18353 + 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
G6849_RS00140 (G6849_00047) 18367..18711 + 345 WP_000556796 conjugal transfer protein TrbA -
G6849_RS00145 (G6849_00048) 18830..19114 + 285 WP_000624194 type-F conjugative transfer system pilin chaperone TraQ -
G6849_RS00150 19101..19327 + 227 Protein_29 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB -

Host bacterium

ID   3712 GenBank   NZ_MT230153
Plasmid name   pESBL171 Incompatibility group   -
Plasmid size   19327 bp Coordinate of oriT [Strand]   1031..1116 [-]
Host baterium   Escherichia coli strain E. coli UB-ESBL171

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -