Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103251
Name   oriT_pR150626 in_silico
Organism   Salmonella enterica subsp. enterica serovar Typhimurium strain R150626
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KY120366 (47490..47542 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pR150626
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2195 GenBank   WP_015059539
Name   t4cp2_HTK57_RS00155_pR150626 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 6254..29711

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTK57_RS00015 (AAIOCJHD_00001) 2112..2618 + 507 WP_001326595 CaiF/GrlA family transcriptional regulator -
HTK57_RS00020 (AAIOCJHD_00002) 2611..2826 + 216 WP_001127357 DUF1187 family protein -
HTK57_RS00025 (AAIOCJHD_00003) 2819..2995 + 177 WP_000753050 hypothetical protein -
HTK57_RS00030 (AAIOCJHD_00004) 3022..3975 + 954 WP_072089442 SPFH domain-containing protein -
HTK57_RS00035 (AAIOCJHD_00005) 4349..4792 + 444 WP_000964330 NfeD family protein -
HTK57_RS00040 (AAIOCJHD_00006) 4796..4966 + 171 WP_000550720 hypothetical protein -
HTK57_RS00045 (AAIOCJHD_00007) 4977..5423 + 447 WP_001243165 hypothetical protein -
HTK57_RS00050 (AAIOCJHD_00009) 5643..5996 + 354 WP_223286767 hypothetical protein -
HTK57_RS00055 (AAIOCJHD_00010) 5993..6250 + 258 WP_000739144 hypothetical protein -
HTK57_RS00060 (AAIOCJHD_00011) 6254..7249 + 996 WP_001028543 type IV secretion system protein virB6
HTK57_RS00065 (AAIOCJHD_00012) 7255..7896 + 642 WP_001425343 type IV secretion system protein -
HTK57_RS00070 (AAIOCJHD_00013) 7898..8152 + 255 WP_001043555 EexN family lipoprotein -
HTK57_RS00075 (AAIOCJHD_00014) 8165..8452 + 288 WP_001032611 EexN family lipoprotein -
HTK57_RS00080 (AAIOCJHD_00015) 8525..9160 + 636 WP_015059536 hypothetical protein -
HTK57_RS00085 (AAIOCJHD_00016) 9260..9511 + 252 WP_000121741 hypothetical protein -
HTK57_RS00090 (AAIOCJHD_00017) 9501..9782 + 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
HTK57_RS00095 (AAIOCJHD_00018) 9850..10149 + 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
HTK57_RS00100 (AAIOCJHD_00019) 10152..11387 + 1236 WP_015059538 TcpQ domain-containing protein -
HTK57_RS00105 (AAIOCJHD_00020) 11393..11830 + 438 WP_000539665 type IV pilus biogenesis protein PilM -
HTK57_RS00110 (AAIOCJHD_00021) 11949..12347 + 399 WP_001153665 hypothetical protein -
HTK57_RS00115 (AAIOCJHD_00022) 12368..12952 + 585 WP_001177113 lytic transglycosylase domain-containing protein virB1
HTK57_RS00380 (AAIOCJHD_00023) 12952..13242 + 291 WP_000865479 conjugal transfer protein -
HTK57_RS00125 (AAIOCJHD_00024) 13313..13633 + 321 WP_000362080 VirB3 family type IV secretion system protein virB3
HTK57_RS00130 (AAIOCJHD_00025) 13639..15996 + 2358 WP_063078682 VirB4 family type IV secretion system protein virb4
HTK57_RS00135 (AAIOCJHD_00027) 16162..16896 + 735 WP_000432282 type IV secretion system protein virB8
HTK57_RS00140 (AAIOCJHD_00028) 16962..17663 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HTK57_RS00145 (AAIOCJHD_00029) 17653..18792 + 1140 WP_000790640 TrbI/VirB10 family protein virB10
HTK57_RS00150 (AAIOCJHD_00030) 18811..19866 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
HTK57_RS00155 (AAIOCJHD_00031) 19882..21840 + 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
HTK57_RS00160 (AAIOCJHD_00032) 21887..22423 + 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
HTK57_RS00165 (AAIOCJHD_00033) 22416..24059 + 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
HTK57_RS00170 (AAIOCJHD_00034) 24098..25420 + 1323 WP_000454142 type 4b pilus protein PilO2 -
HTK57_RS00175 (AAIOCJHD_00035) 25404..25898 + 495 WP_000912553 type IV pilus biogenesis protein PilP -
HTK57_RS00180 (AAIOCJHD_00036) 25923..27461 + 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HTK57_RS00185 (AAIOCJHD_00037) 27452..28561 + 1110 WP_000974903 type II secretion system F family protein -
HTK57_RS00190 (AAIOCJHD_00038) 28606..29163 + 558 WP_000095048 type 4 pilus major pilin -
HTK57_RS00195 (AAIOCJHD_00039) 29229..29711 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HTK57_RS00200 (AAIOCJHD_00040) 29715..30350 + 636 WP_000934977 A24 family peptidase -
HTK57_RS00205 (AAIOCJHD_00041) 30363..31679 + 1317 WP_021500066 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTK57_RS00210 (AAIOCJHD_00042) 31658..31966 - 309 WP_001199277 hypothetical protein -
HTK57_RS00215 (AAIOCJHD_00043) 32015..33139 + 1125 WP_000486716 site-specific integrase -
HTK57_RS00220 (AAIOCJHD_00044) 33151..33804 + 654 WP_170855322 hypothetical protein -
HTK57_RS00225 (AAIOCJHD_00045) 33834..34366 + 533 Protein_44 thermonuclease family protein -


Host bacterium


ID   3694 GenBank   NZ_KY120366
Plasmid name   pR150626 Incompatibility group   IncI2
Plasmid size   59651 bp Coordinate of oriT [Strand]   47490..47542 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Typhimurium strain R150626

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -