Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103245
Name   oriT_pP111 in_silico
Organism   Salmonella enterica subsp. enterica serovar Typhimurium strain P111
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KY120365 (48204..48256 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pP111
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2191 GenBank   WP_015059539
Name   t4cp2_HTK64_RS00135_pP111 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 6246..29076

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTK64_RS00010 (LMCCDMEO_00001) 2104..2610 + 507 WP_001326595 CaiF/GrlA family transcriptional regulator -
HTK64_RS00015 (LMCCDMEO_00002) 2603..2818 + 216 WP_001127357 DUF1187 family protein -
HTK64_RS00020 (LMCCDMEO_00003) 2811..2987 + 177 WP_000753050 hypothetical protein -
HTK64_RS00025 (LMCCDMEO_00004) 3014..3967 + 954 WP_072089442 SPFH domain-containing protein -
HTK64_RS00030 (LMCCDMEO_00005) 4341..4784 + 444 WP_000964330 NfeD family protein -
HTK64_RS00035 (LMCCDMEO_00006) 4788..4958 + 171 WP_000550720 hypothetical protein -
HTK64_RS00040 (LMCCDMEO_00007) 4969..5415 + 447 WP_001243165 hypothetical protein -
HTK64_RS00045 (LMCCDMEO_00009) 5635..5988 + 354 WP_223286767 hypothetical protein -
HTK64_RS00050 (LMCCDMEO_00010) 5985..6242 + 258 WP_000739144 hypothetical protein -
HTK64_RS00055 (LMCCDMEO_00011) 6246..7241 + 996 WP_001028540 type IV secretion system protein virB6
HTK64_RS00060 (LMCCDMEO_00012) 7247..7891 + 645 WP_001310442 type IV secretion system protein -
HTK64_RS00065 (LMCCDMEO_00013) 7900..8124 + 225 WP_000713562 EexN family lipoprotein -
HTK64_RS00070 (LMCCDMEO_00014) 8347..9156 - 810 WP_024237698 DUF5710 domain-containing protein -
HTK64_RS00075 (LMCCDMEO_00015) 9204..9503 + 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
HTK64_RS00080 (LMCCDMEO_00016) 9506..10741 + 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
HTK64_RS00085 (LMCCDMEO_00017) 10747..11184 + 438 WP_034169416 type IV pilus biogenesis protein PilM -
HTK64_RS00090 (LMCCDMEO_00018) 11303..11701 + 399 WP_001153669 hypothetical protein -
HTK64_RS00095 (LMCCDMEO_00019) 11722..12306 + 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
HTK64_RS00375 (LMCCDMEO_00020) 12306..12596 + 291 WP_000865479 conjugal transfer protein -
HTK64_RS00105 (LMCCDMEO_00021) 12667..12987 + 321 WP_000362080 VirB3 family type IV secretion system protein virB3
HTK64_RS00110 (LMCCDMEO_00022) 12993..15350 + 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
HTK64_RS00115 (LMCCDMEO_00024) 15516..16250 + 735 WP_000432282 type IV secretion system protein virB8
HTK64_RS00120 (LMCCDMEO_00025) 16316..17017 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HTK64_RS00125 (LMCCDMEO_00026) 17007..18146 + 1140 WP_034169415 TrbI/VirB10 family protein virB10
HTK64_RS00130 (LMCCDMEO_00027) 18165..19220 + 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
HTK64_RS00135 (LMCCDMEO_00028) 19236..21194 + 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
HTK64_RS00140 (LMCCDMEO_00029) 21241..21777 + 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
HTK64_RS00145 (LMCCDMEO_00030) 21770..23413 + 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
HTK64_RS00150 (LMCCDMEO_00031) 23452..24774 + 1323 WP_000454142 type 4b pilus protein PilO2 -
HTK64_RS00155 (LMCCDMEO_00032) 24758..25252 + 495 WP_000912553 type IV pilus biogenesis protein PilP -
HTK64_RS00160 (LMCCDMEO_00033) 25277..26815 + 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HTK64_RS00165 (LMCCDMEO_00034) 26806..27915 + 1110 WP_000974903 type II secretion system F family protein -
HTK64_RS00170 (LMCCDMEO_00035) 27965..28528 + 564 WP_034169414 type 4 pilus major pilin -
HTK64_RS00175 (LMCCDMEO_00036) 28594..29076 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HTK64_RS00180 (LMCCDMEO_00037) 29080..29715 + 636 WP_000934977 A24 family peptidase -
HTK64_RS00185 (LMCCDMEO_00038) 29728..31002 + 1275 WP_235883108 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTK64_RS00400 31021..31239 + 219 Protein_37 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTK64_RS00195 31610..31894 + 285 WP_235883107 pilus assembly protein -
HTK64_RS00200 32252..32407 + 156 WP_001358489 hypothetical protein -
HTK64_RS00205 (LMCCDMEO_00041) 32730..33854 + 1125 WP_000486716 site-specific integrase -


Host bacterium


ID   3688 GenBank   NZ_KY120365
Plasmid name   pP111 Incompatibility group   IncI2
Plasmid size   60960 bp Coordinate of oriT [Strand]   48204..48256 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Typhimurium strain P111

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -