Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103238 |
| Name | oriT_pEC006  |
| Organism | Escherichia coli strain EC006 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KY471144 (15073..15125 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pEC006
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2184 | GenBank | WP_015059539 |
| Name | t4cp2_HTL23_RS00240_pEC006 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 33984..57442
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTL23_RS00170 (P006_00036) | 29476..30600 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HTL23_RS00175 (P006_00037) | 30649..30957 | + | 309 | WP_001199277 | hypothetical protein | - |
| HTL23_RS00420 | 31240..31461 | + | 222 | Protein_38 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTL23_RS00185 | 31895..32050 | + | 156 | WP_001358489 | hypothetical protein | - |
| HTL23_RS00190 (P006_00038) | 32127..33332 | - | 1206 | WP_236918847 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTL23_RS00195 (P006_00039) | 33345..33980 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HTL23_RS00200 (P006_00040) | 33984..34466 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTL23_RS00205 (P006_00041) | 34533..35090 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HTL23_RS00210 (P006_00042) | 35135..36244 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTL23_RS00215 (P006_00043) | 36235..37773 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTL23_RS00220 (P006_00044) | 37798..38292 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTL23_RS00225 (P006_00045) | 38276..39598 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTL23_RS00230 (P006_00046) | 39637..41280 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTL23_RS00235 (P006_00047) | 41273..41809 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HTL23_RS00240 (P006_00048) | 41856..43814 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTL23_RS00245 (P006_00049) | 43830..44885 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTL23_RS00250 (P006_00050) | 44904..46043 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| HTL23_RS00255 (P006_00051) | 46033..46734 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTL23_RS00260 (P006_00052) | 46800..47534 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTL23_RS00265 (P006_00054) | 47700..50057 | - | 2358 | WP_063078682 | VirB4 family type IV secretion system protein | virb4 |
| HTL23_RS00270 (P006_00055) | 50063..50383 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTL23_RS00405 (P006_00056) | 50454..50744 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTL23_RS00280 (P006_00057) | 50744..51328 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HTL23_RS00285 (P006_00058) | 51349..51747 | - | 399 | WP_001153665 | hypothetical protein | - |
| HTL23_RS00290 (P006_00059) | 51866..52303 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HTL23_RS00295 (P006_00060) | 52309..53544 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HTL23_RS00300 (P006_00061) | 53547..53846 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTL23_RS00305 (P006_00062) | 53914..54195 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HTL23_RS00310 (P006_00063) | 54185..54436 | - | 252 | WP_000121741 | hypothetical protein | - |
| HTL23_RS00315 (P006_00064) | 54536..55171 | - | 636 | WP_015059536 | hypothetical protein | - |
| HTL23_RS00320 (P006_00065) | 55244..55531 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
| HTL23_RS00325 (P006_00066) | 55544..55798 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| HTL23_RS00330 (P006_00067) | 55800..56441 | - | 642 | WP_001425343 | type IV secretion system protein | - |
| HTL23_RS00335 (P006_00068) | 56447..57442 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| HTL23_RS00340 (P006_00069) | 57446..57703 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTL23_RS00345 (P006_00070) | 57700..58053 | - | 354 | WP_223286767 | hypothetical protein | - |
| HTL23_RS00350 (P006_00072) | 58273..58719 | - | 447 | WP_001243165 | hypothetical protein | - |
| HTL23_RS00355 (P006_00073) | 58730..58900 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTL23_RS00360 (P006_00074) | 58904..59347 | - | 444 | WP_000964330 | NfeD family protein | - |
| HTL23_RS00365 (P006_00075) | 59721..60674 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HTL23_RS00370 (P006_00076) | 60701..60877 | - | 177 | WP_000753050 | hypothetical protein | - |
| HTL23_RS00375 (P006_00077) | 60870..61085 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HTL23_RS00380 (P006_00078) | 61078..61584 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3681 | GenBank | NZ_KY471144 |
| Plasmid name | pEC006 | Incompatibility group | IncI2 |
| Plasmid size | 62174 bp | Coordinate of oriT [Strand] | 15073..15125 [-] |
| Host baterium | Escherichia coli strain EC006 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |