Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103216 |
| Name | oriT_pJIE3685-1 |
| Organism | Escherichia coli strain JIE3685 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KY795978 (14218..14270 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pJIE3685-1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2171 | GenBank | WP_015059539 |
| Name | t4cp2_HTM83_RS00235_pJIE3685-1 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 33398..56228
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTM83_RS00170 | 28620..29744 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HTM83_RS00395 | 30077..30295 | + | 219 | Protein_37 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTM83_RS00180 | 30731..30886 | + | 156 | WP_001358489 | hypothetical protein | - |
| HTM83_RS00185 | 31460..32746 | - | 1287 | WP_104730792 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTM83_RS00190 | 32759..33394 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HTM83_RS00195 | 33398..33880 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTM83_RS00200 | 33946..34509 | - | 564 | WP_034169414 | type 4 pilus major pilin | - |
| HTM83_RS00205 | 34559..35668 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTM83_RS00210 | 35659..37197 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTM83_RS00215 | 37222..37716 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTM83_RS00220 | 37700..39022 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTM83_RS00225 | 39061..40704 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTM83_RS00230 | 40697..41233 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HTM83_RS00235 | 41280..43238 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTM83_RS00240 | 43254..44309 | - | 1056 | WP_001542006 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTM83_RS00245 | 44328..45467 | - | 1140 | WP_034169415 | TrbI/VirB10 family protein | virB10 |
| HTM83_RS00250 | 45457..46158 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTM83_RS00255 | 46224..46958 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTM83_RS00260 | 47124..49481 | - | 2358 | WP_000548950 | VirB4 family type IV secretion system protein | virb4 |
| HTM83_RS00265 | 49487..49807 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTM83_RS00390 | 49878..50168 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTM83_RS00275 | 50168..50752 | - | 585 | WP_001177117 | lytic transglycosylase domain-containing protein | virB1 |
| HTM83_RS00280 | 50773..51171 | - | 399 | WP_001153669 | hypothetical protein | - |
| HTM83_RS00285 | 51290..51727 | - | 438 | WP_034169416 | type IV pilus biogenesis protein PilM | - |
| HTM83_RS00290 | 51733..52968 | - | 1236 | WP_034169417 | toxin co-regulated pilus biosynthesis Q family protein | - |
| HTM83_RS00295 | 52971..53270 | - | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTM83_RS00300 | 53318..54127 | + | 810 | WP_024237698 | DUF5710 domain-containing protein | - |
| HTM83_RS00305 | 54350..54574 | - | 225 | WP_000713562 | EexN family lipoprotein | - |
| HTM83_RS00310 | 54583..55227 | - | 645 | WP_001310442 | type IV secretion system protein | - |
| HTM83_RS00315 | 55233..56228 | - | 996 | WP_001028540 | type IV secretion system protein | virB6 |
| HTM83_RS00320 | 56232..56489 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTM83_RS00325 | 56486..56839 | - | 354 | WP_223286767 | hypothetical protein | - |
| HTM83_RS00330 | 57059..57505 | - | 447 | WP_001243165 | hypothetical protein | - |
| HTM83_RS00335 | 57516..57686 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTM83_RS00340 | 57690..58133 | - | 444 | WP_000964330 | NfeD family protein | - |
| HTM83_RS00345 | 58507..59460 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HTM83_RS00350 | 59487..59663 | - | 177 | WP_000753050 | hypothetical protein | - |
| HTM83_RS00355 | 59656..59871 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HTM83_RS00360 | 59864..60370 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3659 | GenBank | NZ_KY795978 |
| Plasmid name | pJIE3685-1 | Incompatibility group | IncI2 |
| Plasmid size | 60960 bp | Coordinate of oriT [Strand] | 14218..14270 [-] |
| Host baterium | Escherichia coli strain JIE3685 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |