Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103213 |
| Name | oriT_pOM97-mcr |
| Organism | Escherichia coli strain OM97 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KY693674 (14218..14270 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pOM97-mcr
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2168 | GenBank | WP_015059539 |
| Name | t4cp2_HTM19_RS00245_pOM97-mcr |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 34824..58990
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTM19_RS00175 | 29882..30037 | + | 156 | WP_001358489 | hypothetical protein | - |
| HTM19_RS00180 | 30318..30602 | + | 285 | WP_172687886 | pilus assembly protein | - |
| HTM19_RS00415 | 31502..31723 | - | 222 | Protein_39 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTM19_RS00405 | 32006..32290 | - | 285 | WP_172687886 | pilus assembly protein | - |
| HTM19_RS00195 | 32928..34172 | - | 1245 | WP_000750517 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTM19_RS00200 | 34185..34820 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HTM19_RS00205 | 34824..35306 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTM19_RS00210 | 35372..35935 | - | 564 | WP_034169414 | type 4 pilus major pilin | - |
| HTM19_RS00215 | 35985..37094 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTM19_RS00220 | 37085..38623 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTM19_RS00225 | 38648..39142 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTM19_RS00230 | 39126..40448 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTM19_RS00235 | 40487..42130 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTM19_RS00240 | 42123..42659 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HTM19_RS00245 | 42706..44664 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTM19_RS00250 | 44680..45735 | - | 1056 | WP_001542006 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTM19_RS00255 | 45754..46893 | - | 1140 | WP_034169415 | TrbI/VirB10 family protein | virB10 |
| HTM19_RS00260 | 46883..47584 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTM19_RS00265 | 47650..48384 | - | 735 | WP_172690217 | type IV secretion system protein | virB8 |
| HTM19_RS00270 | 48550..50907 | - | 2358 | WP_000548950 | VirB4 family type IV secretion system protein | virb4 |
| HTM19_RS00275 | 50913..51233 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTM19_RS00410 | 51304..51594 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTM19_RS00285 | 51594..52178 | - | 585 | WP_001177117 | lytic transglycosylase domain-containing protein | virB1 |
| HTM19_RS00290 | 52199..52597 | - | 399 | WP_001153669 | hypothetical protein | - |
| HTM19_RS00295 | 52716..53183 | - | 468 | WP_257792846 | type IV pilus biogenesis protein PilM | - |
| HTM19_RS00305 | 54495..55730 | - | 1236 | WP_034169417 | toxin co-regulated pilus biosynthesis Q family protein | - |
| HTM19_RS00310 | 55733..56032 | - | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTM19_RS00315 | 56080..56889 | + | 810 | WP_024237698 | DUF5710 domain-containing protein | - |
| HTM19_RS00320 | 57112..57336 | - | 225 | WP_000713562 | EexN family lipoprotein | - |
| HTM19_RS00325 | 57345..57989 | - | 645 | WP_001310442 | type IV secretion system protein | - |
| HTM19_RS00330 | 57995..58990 | - | 996 | WP_001028540 | type IV secretion system protein | virB6 |
| HTM19_RS00335 | 58994..59251 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTM19_RS00340 | 59248..59601 | - | 354 | WP_223286767 | hypothetical protein | - |
| HTM19_RS00345 | 59821..60267 | - | 447 | WP_001243165 | hypothetical protein | - |
| HTM19_RS00350 | 60278..60448 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTM19_RS00355 | 60452..60895 | - | 444 | WP_000964330 | NfeD family protein | - |
| HTM19_RS00360 | 61269..62222 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HTM19_RS00365 | 62249..62425 | - | 177 | WP_000753050 | hypothetical protein | - |
| HTM19_RS00370 | 62418..62633 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HTM19_RS00375 | 62626..63132 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3656 | GenBank | NZ_KY693674 |
| Plasmid name | pOM97-mcr | Incompatibility group | IncI2 |
| Plasmid size | 63722 bp | Coordinate of oriT [Strand] | 14218..14270 [-] |
| Host baterium | Escherichia coli strain OM97 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |