Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103211
Name   oriT_pMcp0221 in_silico
Organism   Escherichia coli strain Mcp0221
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KY565557 (38279..38331 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pMcp0221
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2165 GenBank   WP_063268641
Name   t4cp2_HTL88_RS00055_pMcp0221 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73418.87 Da        Isoelectric Point: 9.2394

>WP_063268641.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGYTAGYNLRFVFILQNEGQGQKSDMYGQEGWTTFTENSGVVLY
YPPKSKNSLAKKISEEIGVRDMKISKRSVSSGGGNTGTSRTRNDEIIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 751..17998

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTL88_RS00010 326..730 + 405 WP_236918862 hypothetical protein -
HTL88_RS00015 751..1335 + 585 WP_063268637 lytic transglycosylase domain-containing protein virB1
HTL88_RS00020 1335..1625 + 291 WP_063268638 conjugal transfer protein -
HTL88_RS00025 1696..2016 + 321 WP_000362081 VirB3 family type IV secretion system protein virB3
HTL88_RS00030 2022..4379 + 2358 WP_063268639 VirB4 family type IV secretion system protein virb4
HTL88_RS00035 4541..5275 + 735 WP_015057166 type IV secretion system protein virB8
HTL88_RS00040 5341..6042 + 702 WP_049824867 TrbG/VirB9 family P-type conjugative transfer protein -
HTL88_RS00045 6032..7171 + 1140 WP_015057165 TrbI/VirB10 family protein virB10
HTL88_RS00050 7190..8245 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
HTL88_RS00055 8261..10219 + 1959 WP_063268641 type IV secretory system conjugative DNA transfer family protein -
HTL88_RS00060 10266..10709 + 444 WP_089623547 ATP-binding protein virb4
HTL88_RS00065 10702..12345 + 1644 WP_045146416 PilN family type IVB pilus formation outer membrane protein -
HTL88_RS00070 12384..13706 + 1323 WP_000454142 type 4b pilus protein PilO2 -
HTL88_RS00075 13690..14184 + 495 WP_045146418 type IV pilus biogenesis protein PilP -
HTL88_RS00080 14209..15747 + 1539 WP_045146419 ATPase, T2SS/T4P/T4SS family virB11
HTL88_RS00085 15738..16847 + 1110 WP_000974900 type II secretion system F family protein -
HTL88_RS00090 16892..17449 + 558 WP_097728049 type 4 pilus major pilin -
HTL88_RS00095 17570..17998 + 429 WP_001326801 lytic transglycosylase domain-containing protein virB1
HTL88_RS00100 18002..18637 + 636 WP_000934978 A24 family peptidase -
HTL88_RS00105 18650..19933 + 1284 WP_172690226 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTL88_RS00110 20257..20517 + 261 WP_198965019 pilus assembly protein -
HTL88_RS00450 20800..21021 + 222 Protein_22 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTL88_RS00120 21434..22558 + 1125 WP_172690227 site-specific integrase -


Host bacterium


ID   3654 GenBank   NZ_KY565557
Plasmid name   pMcp0221 Incompatibility group   IncI2
Plasmid size   64664 bp Coordinate of oriT [Strand]   38279..38331 [+]
Host baterium   Escherichia coli strain Mcp0221

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -