Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103205
Name   oriT_pEC019 in_silico
Organism   Escherichia coli strain EC019
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KY471145 (15068..15120 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pEC019
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2157 GenBank   WP_015059539
Name   t4cp2_HTL15_RS00235_pEC019 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 33386..50728

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTL15_RS00170 (P019_00035) 28804..29457 - 654 WP_170855322 hypothetical protein -
HTL15_RS00175 (P019_00036) 29469..30593 - 1125 WP_000486716 site-specific integrase -
HTL15_RS00180 30915..31070 - 156 WP_001358489 hypothetical protein -
HTL15_RS00185 (P019_00038) 31494..32734 - 1241 Protein_38 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTL15_RS00190 (P019_00039) 32747..33382 - 636 WP_000934977 A24 family peptidase -
HTL15_RS00195 (P019_00040) 33386..33868 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HTL15_RS00200 (P019_00041) 33935..34492 - 558 WP_000095048 type 4 pilus major pilin -
HTL15_RS00205 (P019_00042) 34537..35646 - 1110 WP_000974903 type II secretion system F family protein -
HTL15_RS00210 (P019_00043) 35637..37175 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HTL15_RS00215 (P019_00044) 37200..37694 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
HTL15_RS00220 (P019_00045) 37678..39000 - 1323 WP_000454142 type 4b pilus protein PilO2 -
HTL15_RS00225 (P019_00046) 39039..40682 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
HTL15_RS00230 (P019_00047) 40675..41211 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
HTL15_RS00235 (P019_00048) 41258..43216 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
HTL15_RS00240 (P019_00049) 43232..44287 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
HTL15_RS00245 (P019_00050) 44306..45444 - 1139 Protein_50 TrbI/VirB10 family protein -
HTL15_RS00250 (P019_00051) 45434..46135 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HTL15_RS00255 (P019_00052) 46201..46935 - 735 WP_000432282 type IV secretion system protein virB8
HTL15_RS00260 (P019_00054) 47101..49458 - 2358 WP_063078682 VirB4 family type IV secretion system protein virb4
HTL15_RS00265 (P019_00055) 49464..49784 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
HTL15_RS00405 49855..50145 - 291 WP_000865479 conjugal transfer protein -
HTL15_RS00275 (P019_00056) 50030..50728 - 699 WP_236918851 lytic transglycosylase domain-containing protein virB1
HTL15_RS00280 (P019_00057) 50749..51147 - 399 WP_001153665 hypothetical protein -
HTL15_RS00285 (P019_00058) 51266..51703 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
HTL15_RS00290 (P019_00059) 51709..52944 - 1236 WP_015059538 TcpQ domain-containing protein -
HTL15_RS00295 (P019_00060) 52947..53246 - 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
HTL15_RS00300 (P019_00061) 53314..53595 - 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
HTL15_RS00305 (P019_00062) 53585..53836 - 252 WP_000121741 hypothetical protein -
HTL15_RS00310 (P019_00063) 53936..54571 - 636 WP_015059536 hypothetical protein -
HTL15_RS00315 (P019_00064) 54644..54931 - 288 WP_001032611 EexN family lipoprotein -
HTL15_RS00320 (P019_00065) 54944..55198 - 255 WP_001043555 EexN family lipoprotein -


Host bacterium


ID   3648 GenBank   NZ_KY471145
Plasmid name   pEC019 Incompatibility group   IncI2
Plasmid size   61572 bp Coordinate of oriT [Strand]   15068..15120 [-]
Host baterium   Escherichia coli strain EC019

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -