Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103202
Name   oriT_pM16-13 in_silico
Organism   Klebsiella pneumoniae strain M16-13
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KY751925 (37330..37415 [-], 86 nt)
oriT length   86 nt
IRs (inverted repeats)      61..68, 73..80  (TTGGTGGT..ACCACCAA)
 27..34, 37..44  (GCAAAAAC..GTTTTTGC)
 8..14, 20..26  (TGATTTA..TAAATCA)
Location of nic site      53..54
Conserved sequence flanking the
  nic site    		  TGTGTGGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_pM16-13
AATTACATGATTTAAAACGTAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2155 GenBank   WP_000069777
Name   traC_HTM27_RS00315_pM16-13 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99195.86 Da        Isoelectric Point: 6.1126

>WP_000069777.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNRKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(290-447)

TraG P-loop domain (P-loop_TraG)

(468-764)

TraC protein (TraC_F_IV)

(39-277)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 36762..48400

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTM27_RS00205 32139..32564 + 426 WP_000422741 transposase -
HTM27_RS00210 32561..32911 + 351 WP_000624722 IS66 family insertion sequence element accessory protein TnpB -
HTM27_RS00215 32942..34555 + 1614 WP_000080200 IS66-like element ISEc23 family transposase -
HTM27_RS00705 34640..34936 - 297 Protein_44 hypothetical protein -
HTM27_RS00710 35007..35213 + 207 WP_001087957 hypothetical protein -
HTM27_RS00225 35237..35533 + 297 WP_001272251 hypothetical protein -
HTM27_RS00230 35644..36465 + 822 WP_001234445 DUF932 domain-containing protein -
HTM27_RS00235 36762..37364 - 603 WP_000243713 transglycosylase SLT domain-containing protein virB1
HTM27_RS00240 37687..38070 + 384 WP_001354030 conjugal transfer relaxosome DNA-binding protein TraM -
HTM27_RS00245 38264..38935 + 672 WP_000283561 conjugal transfer transcriptional regulator TraJ -
HTM27_RS00250 39072..39299 + 228 WP_000089263 conjugal transfer relaxosome protein TraY -
HTM27_RS00255 39332..39691 + 360 WP_001098992 type IV conjugative transfer system pilin TraA -
HTM27_RS00260 39706..40017 + 312 WP_000012113 type IV conjugative transfer system protein TraL traL
HTM27_RS00265 40039..40605 + 567 WP_000399780 type IV conjugative transfer system protein TraE traE
HTM27_RS00270 40592..41320 + 729 WP_001230772 type-F conjugative transfer system secretin TraK traK
HTM27_RS00275 41320..42771 + 1452 WP_000146675 F-type conjugal transfer pilus assembly protein TraB traB
HTM27_RS00280 42761..43327 + 567 WP_000896599 conjugal transfer pilus-stabilizing protein TraP -
HTM27_RS00285 43314..43634 + 321 WP_001057307 conjugal transfer protein TrbD -
HTM27_RS00290 43631..44146 + 516 WP_000809881 type IV conjugative transfer system lipoprotein TraV traV
HTM27_RS00295 44281..44502 + 222 WP_001278683 conjugal transfer protein TraR -
HTM27_RS00300 44495..44971 + 477 WP_000549587 hypothetical protein -
HTM27_RS00305 45051..45269 + 219 WP_000556745 hypothetical protein -
HTM27_RS00310 45297..45644 + 348 WP_000836682 hypothetical protein -
HTM27_RS00315 45770..48400 + 2631 WP_000069777 type IV secretion system protein TraC virb4
HTM27_RS00320 48401..49129 - 729 WP_004152640 plasmid SOS inhibition protein A -
HTM27_RS00325 49126..49557 - 432 WP_004152641 conjugation system SOS inhibitor PsiB -
HTM27_RS00330 49602..51660 - 2059 Protein_67 ParB/RepB/Spo0J family partition protein -
HTM27_RS00335 51767..52036 - 270 WP_000339857 hypothetical protein -

Host bacterium

ID   3645 GenBank   NZ_KY751925
Plasmid name   pM16-13 Incompatibility group   IncFII
Plasmid size   111951 bp Coordinate of oriT [Strand]   37330..37415 [-]
Host baterium   Klebsiella pneumoniae strain M16-13

Cargo genes

Drug resistance gene   blaCTX-M-15, blaTEM-1B, tet(A), aac(6')-Ib-cr, blaOXA-1, catB3, ARR-3, qacE, sul1, qnrB4, blaDHA-1, mph(A), aph(3')-Ia
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -