Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103195
Name   oriT_pE15017_00 in_silico
Organism   Escherichia coli strain E15017_00
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KX772778 (18441..18493 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pE15017_00
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2147 GenBank   WP_015059539
Name   t4cp2_HTI99_RS00265_pE15017_00 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 36691..60148

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTI99_RS00200 (pE15017_040) 32016..32669 - 654 WP_170852113 hypothetical protein -
HTI99_RS00205 (pE15017_041) 32681..33805 - 1125 WP_000486716 site-specific integrase -
HTI99_RS00450 33868..34089 + 222 Protein_44 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTI99_RS00215 34753..36039 - 1287 WP_100783610 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTI99_RS00220 (pE15017_044) 36052..36687 - 636 WP_000934977 A24 family peptidase -
HTI99_RS00225 (pE15017_045) 36691..37173 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HTI99_RS00230 (pE15017_046) 37239..37796 - 558 WP_000095048 type 4 pilus major pilin -
HTI99_RS00235 (pE15017_047) 37841..38950 - 1110 WP_000974903 type II secretion system F family protein -
HTI99_RS00240 (pE15017_048) 38941..40479 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HTI99_RS00245 (pE15017_049) 40504..40998 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
HTI99_RS00250 (pE15017_050) 40982..42304 - 1323 WP_000454142 type 4b pilus protein PilO2 -
HTI99_RS00255 (pE15017_051) 42343..43986 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
HTI99_RS00260 (pE15017_052) 43979..44515 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
HTI99_RS00265 (pE15017_053) 44562..46520 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
HTI99_RS00270 (pE15017_054) 46536..47591 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
HTI99_RS00275 (pE15017_055) 47610..48749 - 1140 WP_000790640 TrbI/VirB10 family protein virB10
HTI99_RS00280 (pE15017_056) 48739..49440 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HTI99_RS00285 (pE15017_057) 49506..50240 - 735 WP_000432282 type IV secretion system protein virB8
HTI99_RS00290 (pE15017_058) 50406..52763 - 2358 WP_063078682 VirB4 family type IV secretion system protein virb4
HTI99_RS00295 (pE15017_059) 52769..53089 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
HTI99_RS00435 (pE15017_060) 53160..53450 - 291 WP_000865479 conjugal transfer protein -
HTI99_RS00305 (pE15017_061) 53450..54034 - 585 WP_001177113 lytic transglycosylase domain-containing protein virB1
HTI99_RS00310 (pE15017_062) 54055..54453 - 399 WP_072643816 hypothetical protein -
HTI99_RS00315 (pE15017_063) 54572..55009 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
HTI99_RS00320 (pE15017_064) 55015..56250 - 1236 WP_015059538 TcpQ domain-containing protein -
HTI99_RS00325 (pE15017_065) 56253..56552 - 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
HTI99_RS00330 (pE15017_066) 56620..56901 - 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
HTI99_RS00335 (pE15017_067) 56891..57142 - 252 WP_000121741 hypothetical protein -
HTI99_RS00340 (pE15017_068) 57242..57877 - 636 WP_015059536 hypothetical protein -
HTI99_RS00345 (pE15017_069) 57950..58237 - 288 WP_001032611 EexN family lipoprotein -
HTI99_RS00350 (pE15017_070) 58250..58504 - 255 WP_001043555 EexN family lipoprotein -
HTI99_RS00355 (pE15017_071) 58506..59147 - 642 WP_001425343 type IV secretion system protein -
HTI99_RS00360 (pE15017_072) 59153..60148 - 996 WP_001028543 type IV secretion system protein virB6
HTI99_RS00365 (pE15017_073) 60152..60409 - 258 WP_000739144 hypothetical protein -
HTI99_RS00370 (pE15017_074) 60406..60759 - 354 WP_223286767 hypothetical protein -
HTI99_RS00375 (pE15017_076) 60979..61425 - 447 WP_001243165 hypothetical protein -
HTI99_RS00380 (pE15017_077) 61436..61606 - 171 WP_000550720 hypothetical protein -
HTI99_RS00385 (pE15017_078) 61610..62053 - 444 WP_000964330 NfeD family protein -
HTI99_RS00390 (pE15017_079) 62427..63380 - 954 WP_072089442 SPFH domain-containing protein -
HTI99_RS00395 (pE15017_080) 63407..63583 - 177 WP_000753050 hypothetical protein -
HTI99_RS00400 (pE15017_081) 63576..63791 - 216 WP_001127357 DUF1187 family protein -
HTI99_RS00405 (pE15017_082) 63784..64290 - 507 WP_001326595 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   3638 GenBank   NZ_KX772778
Plasmid name   pE15017_00 Incompatibility group   IncI2
Plasmid size   65375 bp Coordinate of oriT [Strand]   18441..18493 [-]
Host baterium   Escherichia coli strain E15017_00

Cargo genes


Drug resistance gene   blaCTX-M-55, mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -