Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103190 |
| Name | oriT_pHSSH23-MCR1  |
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KX856068 (13125..13177 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pHSSH23-MCR1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2142 | GenBank | WP_015059539 |
| Name | t4cp2_HTK04_RS00240_pHSSH23-MCR1 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 32608..56065
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTK04_RS00175 | 27933..28586 | - | 654 | WP_170855322 | hypothetical protein | - |
| HTK04_RS00180 | 28598..29722 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HTK04_RS00420 | 29785..30006 | + | 222 | Protein_38 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTK04_RS00190 | 30670..31956 | - | 1287 | WP_015057162 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTK04_RS00195 | 31969..32604 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HTK04_RS00200 | 32608..33090 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTK04_RS00205 | 33156..33713 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HTK04_RS00210 | 33758..34867 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTK04_RS00215 | 34858..36396 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTK04_RS00220 | 36421..36915 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTK04_RS00225 | 36899..38221 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTK04_RS00230 | 38260..39903 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTK04_RS00235 | 39896..40432 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HTK04_RS00240 | 40479..42437 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTK04_RS00245 | 42453..43508 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTK04_RS00250 | 43527..44666 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| HTK04_RS00255 | 44656..45357 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTK04_RS00260 | 45423..46157 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTK04_RS00265 | 46323..48680 | - | 2358 | WP_063078682 | VirB4 family type IV secretion system protein | virb4 |
| HTK04_RS00270 | 48686..49006 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTK04_RS00405 | 49077..49367 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTK04_RS00280 | 49367..49951 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HTK04_RS00285 | 49972..50370 | - | 399 | WP_001153665 | hypothetical protein | - |
| HTK04_RS00290 | 50489..50926 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HTK04_RS00295 | 50932..52167 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HTK04_RS00300 | 52170..52469 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTK04_RS00305 | 52537..52818 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HTK04_RS00310 | 52808..53059 | - | 252 | WP_000121741 | hypothetical protein | - |
| HTK04_RS00315 | 53159..53794 | - | 636 | WP_015059536 | hypothetical protein | - |
| HTK04_RS00320 | 53867..54154 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
| HTK04_RS00325 | 54167..54421 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| HTK04_RS00330 | 54423..55064 | - | 642 | WP_001425343 | type IV secretion system protein | - |
| HTK04_RS00335 | 55070..56065 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| HTK04_RS00340 | 56069..56326 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTK04_RS00345 | 56323..56676 | - | 354 | WP_223286767 | hypothetical protein | - |
| HTK04_RS00350 | 56896..57171 | - | 276 | WP_226126071 | hypothetical protein | - |
| HTK04_RS00355 | 57352..57522 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTK04_RS00360 | 57526..57969 | - | 444 | WP_000964330 | NfeD family protein | - |
| HTK04_RS00365 | 58343..59296 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HTK04_RS00370 | 59323..59499 | - | 177 | WP_000753050 | hypothetical protein | - |
| HTK04_RS00375 | 59492..59707 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HTK04_RS00380 | 59700..60206 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3633 | GenBank | NZ_KX856068 |
| Plasmid name | pHSSH23-MCR1 | Incompatibility group | IncI2 |
| Plasmid size | 60859 bp | Coordinate of oriT [Strand] | 13125..13177 [-] |
| Host baterium | Salmonella enterica subsp. enterica serovar Enteritidis |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |