Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103176 |
| Name | oriT_p12181-KPC  |
| Organism | Klebsiella pneumoniae strain 12181 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KY270850 (52351..52400 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
TGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_p12181-KPC
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2125 | GenBank | WP_013023832 |
| Name | traD_HTK75_RS00130_p12181-KPC |
UniProt ID | _ |
| Length | 770 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 85974.10 Da Isoelectric Point: 5.1149
>WP_013023832.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDYVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDYVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 22341..52958
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTK75_RS00130 | 22341..24653 | - | 2313 | WP_013023832 | type IV conjugative transfer system coupling protein TraD | virb4 |
| HTK75_RS00135 | 24780..25469 | - | 690 | WP_013023831 | hypothetical protein | - |
| HTK75_RS00140 | 25662..26393 | - | 732 | WP_013023830 | conjugal transfer complement resistance protein TraT | - |
| HTK75_RS00145 | 26579..27112 | - | 534 | WP_014343486 | conjugal transfer protein TraS | - |
| HTK75_RS00150 | 27115..29964 | - | 2850 | WP_013609534 | conjugal transfer mating-pair stabilization protein TraG | traG |
| HTK75_RS00155 | 29964..31343 | - | 1380 | WP_014343487 | conjugal transfer pilus assembly protein TraH | traH |
| HTK75_RS00160 | 31321..31764 | - | 444 | WP_013023828 | F-type conjugal transfer protein TrbF | - |
| HTK75_RS00165 | 31832..32800 | - | 969 | WP_013362812 | IS5-like element IS903B family transposase | - |
| HTK75_RS00170 | 32876..33433 | - | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| HTK75_RS00175 | 33405..33644 | - | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| HTK75_RS00180 | 33655..34407 | - | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| HTK75_RS00185 | 34428..34754 | - | 327 | WP_004152676 | hypothetical protein | - |
| HTK75_RS00190 | 34767..35015 | - | 249 | WP_013214029 | hypothetical protein | - |
| HTK75_RS00195 | 34993..35247 | - | 255 | WP_004152674 | conjugal transfer protein TrbE | - |
| HTK75_RS00200 | 35279..37234 | - | 1956 | WP_014343489 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| HTK75_RS00205 | 37293..37931 | - | 639 | WP_004193871 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| HTK75_RS00210 | 37944..38933 | - | 990 | WP_013214027 | conjugal transfer pilus assembly protein TraU | traU |
| HTK75_RS00215 | 38930..39331 | - | 402 | WP_004194979 | hypothetical protein | - |
| HTK75_RS00220 | 39366..40001 | - | 636 | WP_013214026 | type-F conjugative transfer system protein TraW | traW |
| HTK75_RS00225 | 40001..40390 | - | 390 | WP_013214025 | type-F conjugative transfer system protein TrbI | - |
| HTK75_RS00230 | 40390..43029 | - | 2640 | WP_013214024 | type IV secretion system protein TraC | virb4 |
| HTK75_RS00235 | 43101..43499 | - | 399 | WP_014343490 | hypothetical protein | - |
| HTK75_RS00240 | 43876..44280 | - | 405 | WP_004197817 | hypothetical protein | - |
| HTK75_RS00245 | 44347..44658 | - | 312 | WP_013214022 | hypothetical protein | - |
| HTK75_RS00250 | 44659..44877 | - | 219 | WP_004195468 | hypothetical protein | - |
| HTK75_RS00255 | 45200..45592 | - | 393 | Protein_49 | type IV conjugative transfer system lipoprotein TraV | - |
| HTK75_RS00260 | 45649..46617 | - | 969 | WP_013362812 | IS5-like element IS903B family transposase | - |
| HTK75_RS00265 | 46647..46850 | - | 204 | Protein_51 | type IV conjugative transfer system lipoprotein TraV | - |
| HTK75_RS00270 | 46922..48346 | - | 1425 | WP_013214020 | F-type conjugal transfer pilus assembly protein TraB | traB |
| HTK75_RS00275 | 48346..49086 | - | 741 | WP_013214019 | type-F conjugative transfer system secretin TraK | traK |
| HTK75_RS00280 | 49073..49639 | - | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| HTK75_RS00285 | 49659..49964 | - | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
| HTK75_RS00290 | 49978..50346 | - | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| HTK75_RS00295 | 50408..50614 | - | 207 | WP_171773970 | TraY domain-containing protein | - |
| HTK75_RS00300 | 50729..51466 | - | 738 | WP_013214018 | conjugal transfer protein TrbJ | - |
| HTK75_RS00305 | 51666..52082 | - | 417 | WP_014343494 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HTK75_RS00310 | 52473..52958 | + | 486 | WP_014343495 | transglycosylase SLT domain-containing protein | virB1 |
| HTK75_RS00315 | 52991..53320 | - | 330 | WP_013214015 | DUF5983 family protein | - |
| HTK75_RS00320 | 53353..54174 | - | 822 | WP_004152492 | DUF932 domain-containing protein | - |
| HTK75_RS00325 | 54999..55562 | - | 564 | WP_014343514 | methyltransferase | - |
| HTK75_RS00330 | 55610..56965 | - | 1356 | WP_014343515 | DUF3560 domain-containing protein | - |
| HTK75_RS00335 | 57017..57247 | - | 231 | WP_001568051 | hypothetical protein | - |
| HTK75_RS00340 | 57339..57566 | - | 228 | WP_001568050 | hypothetical protein | - |
Host bacterium
| ID | 3619 | GenBank | NZ_KY270850 |
| Plasmid name | p12181-KPC | Incompatibility group | IncFII |
| Plasmid size | 140093 bp | Coordinate of oriT [Strand] | 52351..52400 [+] |
| Host baterium | Klebsiella pneumoniae strain 12181 |
Cargo genes
| Drug resistance gene | aac(3)-IId, blaKPC-2, dfrA25, qacE, sul1, mph(A), aph(6)-Id, aph(3'')-Ib, sul2 |
| Virulence gene | - |
| Metal resistance gene | merR, merT, merP, merA, merD, merE |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |