Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103169
Name   oriT_pCRKP-59-KPC in_silico
Organism   Klebsiella pneumoniae strain CRKP-59-KPC
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KX928752 (171452..171575 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      92..99, 113..120  (ATAATGTA..TACATTAT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_pCRKP-59-KPC
GGTTGGTGGTTCTCACCACCAAAAGCACCACACACTACGCAAAAACAAGTTTTTGCTGATTTGCTACTTGAATCATTAACTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATAAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2116 GenBank   WP_023356304
Name   traD_HTK19_RS00835_pCRKP-59-KPC insolico UniProt ID   _
Length   738 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 738 a.a.        Molecular weight: 83847.55 Da        Isoelectric Point: 5.1657

>WP_023356304.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLILWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASGEGVTQAEQPQQPQQPQQPQQ
PQQPQQPQQPQQPQQPVSSVINDKKSDAGVSVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYE
AWQQENHPDIQQQMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

F sex factor protein N terminal (TraD_N)

(32-128)

  Protein structure



No available structure.



ID   2117 GenBank   WP_001064258
Name   traC_HTK19_RS00940_pCRKP-59-KPC insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99195.72 Da        Isoelectric Point: 5.8689

>WP_001064258.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLKSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNYKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFQPLQRDMIGKFGAARDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

TraG P-loop domain (P-loop_TraG)

(467-763)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 143307..172147

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTK19_RS00835 143307..145523 - 2217 WP_023356304 type IV conjugative transfer system coupling protein TraD virb4
HTK19_RS00840 145520..146299 - 780 WP_000199914 hypothetical protein -
HTK19_RS00845 146502..147233 - 732 WP_000850429 conjugal transfer complement resistance protein TraT -
HTK19_RS00850 147265..147762 - 498 WP_000605862 entry exclusion protein -
HTK19_RS00855 147781..150600 - 2820 WP_001007062 conjugal transfer mating-pair stabilization protein TraG traG
HTK19_RS00860 150597..151968 - 1372 Protein_172 conjugal transfer pilus assembly protein TraH -
HTK19_RS00865 151955..152347 - 393 WP_000659962 F-type conjugal transfer protein TrbF -
HTK19_RS00870 152328..152675 - 348 WP_071571857 P-type conjugative transfer protein TrbJ -
HTK19_RS00875 152605..153150 - 546 WP_000059829 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HTK19_RS00880 153137..153421 - 285 WP_001617873 type-F conjugative transfer system pilin chaperone TraQ -
HTK19_RS00885 153548..153868 - 321 WP_001348757 conjugal transfer protein TrbA -
HTK19_RS00900 155877..156626 - 750 WP_001348630 type-F conjugative transfer system pilin assembly protein TraF traF
HTK19_RS00905 156613..156870 - 258 WP_000864347 conjugal transfer protein TrbE -
HTK19_RS00910 156897..158747 - 1851 WP_000821866 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HTK19_RS00915 158744..159382 - 639 WP_001080259 type-F conjugative transfer system pilin assembly protein TrbC trbC
HTK19_RS00920 159391..159696 - 306 WP_000224413 hypothetical protein -
HTK19_RS00925 159726..160718 - 993 WP_000830190 conjugal transfer pilus assembly protein TraU traU
HTK19_RS00930 160715..161347 - 633 WP_001203727 type-F conjugative transfer system protein TraW traW
HTK19_RS00935 161344..161730 - 387 WP_000214084 type-F conjugative transfer system protein TrbI -
HTK19_RS00940 161727..164354 - 2628 WP_001064258 type IV secretion system protein TraC virb4
HTK19_RS00945 164514..164735 - 222 WP_001278694 conjugal transfer protein TraR -
HTK19_RS00950 164870..165385 - 516 WP_000809886 type IV conjugative transfer system lipoprotein TraV traV
HTK19_RS00955 165385..165696 - 312 WP_001057272 conjugal transfer protein TrbD -
HTK19_RS00960 165683..166249 - 567 WP_001617877 conjugal transfer pilus-stabilizing protein TraP -
HTK19_RS00965 166239..167690 - 1452 WP_000146687 F-type conjugal transfer pilus assembly protein TraB traB
HTK19_RS00970 167690..168418 - 729 WP_001230808 type-F conjugative transfer system secretin TraK traK
HTK19_RS00975 168405..168971 - 567 WP_000399791 type IV conjugative transfer system protein TraE traE
HTK19_RS00980 168993..169304 - 312 WP_000012107 type IV conjugative transfer system protein TraL traL
HTK19_RS00985 169309..169671 - 363 WP_000338606 type IV conjugative transfer system pilin TraA -
HTK19_RS00990 169705..169932 - 228 WP_001254388 conjugal transfer relaxosome protein TraY -
HTK19_RS00995 170020..170697 - 678 WP_001348626 PAS domain-containing protein -
HTK19_RS01000 170831..171214 - 384 WP_001151566 conjugal transfer relaxosome DNA-binding protein TraM -
HTK19_RS01005 171545..172147 + 603 WP_000243712 transglycosylase SLT domain-containing protein virB1
HTK19_RS01010 172444..173265 - 822 WP_001234469 DUF932 domain-containing protein -
HTK19_RS01015 173384..173671 - 288 WP_000107535 hypothetical protein -
HTK19_RS01020 173646..173903 - 258 WP_172688936 single-stranded DNA-binding protein -
HTK19_RS01300 173973..174137 + 165 Protein_205 hypothetical protein -
HTK19_RS01305 174876..176542 + 1667 Protein_206 group II intron reverse transcriptase/maturase -
HTK19_RS01040 176937..177062 - 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -

Host bacterium

ID   3612 GenBank   NZ_KX928752
Plasmid name   pCRKP-59-KPC Incompatibility group   IncY
Plasmid size   216976 bp Coordinate of oriT [Strand]   171452..171575 [-]
Host baterium   Klebsiella pneumoniae strain CRKP-59-KPC

Cargo genes

Drug resistance gene   qepA1, rmtB, blaTEM-1B, aac(3)-IId, blaKPC-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA7