Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103154 |
| Name | oriT_pSh418-m3  |
| Organism | Shigella sonnei strain SH11Sh418 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KY363997 (15319..15371 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pSh418-m3
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2098 | GenBank | WP_015059539 |
| Name | t4cp2_HPG37_RS00255_pSh418-m3 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 36077..59534
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HPG37_RS00190 | 31566..32690 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HPG37_RS00195 | 32739..33047 | + | 309 | WP_001199277 | hypothetical protein | - |
| HPG37_RS00435 | 33330..33551 | + | 222 | Protein_42 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HPG37_RS00205 | 34172..35425 | - | 1254 | WP_010895887 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HPG37_RS00210 | 35438..36073 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HPG37_RS00215 | 36077..36559 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HPG37_RS00220 | 36625..37182 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HPG37_RS00225 | 37227..38336 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HPG37_RS00230 | 38327..39865 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HPG37_RS00235 | 39890..40384 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HPG37_RS00240 | 40368..41690 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HPG37_RS00245 | 41729..43372 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HPG37_RS00250 | 43365..43901 | - | 537 | WP_137547091 | ATP-binding protein | virb4 |
| HPG37_RS00255 | 43948..45906 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HPG37_RS00260 | 45922..46977 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HPG37_RS00265 | 46996..48135 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| HPG37_RS00270 | 48125..48826 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HPG37_RS00275 | 48892..49626 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HPG37_RS00280 | 49792..52149 | - | 2358 | WP_063078682 | VirB4 family type IV secretion system protein | virb4 |
| HPG37_RS00285 | 52155..52475 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HPG37_RS00420 | 52546..52836 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HPG37_RS00295 | 52836..53420 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HPG37_RS00300 | 53441..53839 | - | 399 | WP_001153665 | hypothetical protein | - |
| HPG37_RS00305 | 53958..54395 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HPG37_RS00310 | 54401..55636 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HPG37_RS00315 | 55639..55938 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HPG37_RS00320 | 56006..56287 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HPG37_RS00325 | 56277..56528 | - | 252 | WP_000121741 | hypothetical protein | - |
| HPG37_RS00330 | 56628..57263 | - | 636 | WP_015059536 | hypothetical protein | - |
| HPG37_RS00335 | 57336..57623 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
| HPG37_RS00340 | 57636..57890 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| HPG37_RS00345 | 57892..58533 | - | 642 | WP_001425343 | type IV secretion system protein | - |
| HPG37_RS00350 | 58539..59534 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| HPG37_RS00355 | 59538..59795 | - | 258 | WP_000739144 | hypothetical protein | - |
| HPG37_RS00360 | 59792..60145 | - | 354 | WP_223286767 | hypothetical protein | - |
| HPG37_RS00365 | 60365..60811 | - | 447 | WP_001243165 | hypothetical protein | - |
| HPG37_RS00370 | 60822..60992 | - | 171 | WP_000550720 | hypothetical protein | - |
| HPG37_RS00375 | 60996..61439 | - | 444 | WP_000964330 | NfeD family protein | - |
| HPG37_RS00380 | 61813..62766 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HPG37_RS00385 | 62793..62969 | - | 177 | WP_000753050 | hypothetical protein | - |
| HPG37_RS00390 | 62962..63177 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HPG37_RS00395 | 63170..63676 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3597 | GenBank | NZ_KY363997 |
| Plasmid name | pSh418-m3 | Incompatibility group | IncI2 |
| Plasmid size | 64266 bp | Coordinate of oriT [Strand] | 15319..15371 [-] |
| Host baterium | Shigella sonnei strain SH11Sh418 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |