Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103142 |
| Name | oriT_pSh487-m4  |
| Organism | Shigella sonnei strain SH11Sh487 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KY363996 (15344..15396 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pSh487-m4
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2090 | GenBank | WP_015059539 |
| Name | t4cp2_HPF82_RS00255_pSh487-m4 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 35323..58780
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HPF82_RS00190 | 30812..31936 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HPF82_RS00195 | 32259..32414 | - | 156 | WP_001358489 | hypothetical protein | - |
| HPF82_RS00435 | 32500..32721 | + | 222 | Protein_41 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HPF82_RS00205 | 33385..34671 | - | 1287 | WP_015057162 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HPF82_RS00210 | 34684..35319 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HPF82_RS00215 | 35323..35805 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HPF82_RS00220 | 35871..36428 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HPF82_RS00225 | 36473..37582 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HPF82_RS00230 | 37573..39111 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HPF82_RS00235 | 39136..39630 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HPF82_RS00240 | 39614..40936 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HPF82_RS00245 | 40975..42618 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HPF82_RS00250 | 42611..43147 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HPF82_RS00255 | 43194..45152 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HPF82_RS00260 | 45168..46223 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HPF82_RS00265 | 46242..47381 | - | 1140 | WP_171264649 | TrbI/VirB10 family protein | virB10 |
| HPF82_RS00270 | 47371..48072 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HPF82_RS00275 | 48138..48872 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HPF82_RS00280 | 49038..51395 | - | 2358 | WP_063078682 | VirB4 family type IV secretion system protein | virb4 |
| HPF82_RS00285 | 51401..51721 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HPF82_RS00420 | 51792..52082 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HPF82_RS00295 | 52082..52666 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HPF82_RS00300 | 52687..53085 | - | 399 | WP_001153665 | hypothetical protein | - |
| HPF82_RS00305 | 53204..53641 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HPF82_RS00310 | 53647..54882 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HPF82_RS00315 | 54885..55184 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HPF82_RS00320 | 55252..55533 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HPF82_RS00325 | 55523..55774 | - | 252 | WP_000121741 | hypothetical protein | - |
| HPF82_RS00330 | 55874..56509 | - | 636 | WP_015059536 | hypothetical protein | - |
| HPF82_RS00335 | 56582..56869 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
| HPF82_RS00340 | 56882..57136 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| HPF82_RS00345 | 57138..57779 | - | 642 | WP_001425343 | type IV secretion system protein | - |
| HPF82_RS00350 | 57785..58780 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| HPF82_RS00355 | 58784..59041 | - | 258 | WP_000739144 | hypothetical protein | - |
| HPF82_RS00360 | 59038..59391 | - | 354 | WP_223286767 | hypothetical protein | - |
| HPF82_RS00365 | 59611..60057 | - | 447 | WP_001243165 | hypothetical protein | - |
| HPF82_RS00370 | 60068..60238 | - | 171 | WP_000550720 | hypothetical protein | - |
| HPF82_RS00375 | 60242..60685 | - | 444 | WP_000964330 | NfeD family protein | - |
| HPF82_RS00380 | 61059..62012 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HPF82_RS00385 | 62039..62215 | - | 177 | WP_000753050 | hypothetical protein | - |
| HPF82_RS00390 | 62208..62423 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HPF82_RS00395 | 62416..62922 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3585 | GenBank | NZ_KY363996 |
| Plasmid name | pSh487-m4 | Incompatibility group | IncI2 |
| Plasmid size | 63512 bp | Coordinate of oriT [Strand] | 15344..15396 [-] |
| Host baterium | Shigella sonnei strain SH11Sh487 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |