Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103140 |
| Name | oriT_p1083-CTXM  |
| Organism | Shigella sonnei strain 1083 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KX827311 (17699..17751 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_p1083-CTXM
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2088 | GenBank | WP_000338974 |
| Name | t4cp2_HPG07_RS00270_p1083-CTXM |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73347.89 Da Isoelectric Point: 9.1391
>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 33573..57118
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HPG07_RS00205 | 28898..29551 | - | 654 | WP_015387348 | hypothetical protein | - |
| HPG07_RS00210 | 29563..30687 | - | 1125 | WP_000486719 | site-specific integrase | - |
| HPG07_RS00215 | 31022..31282 | - | 261 | WP_198965019 | pilus assembly protein | - |
| HPG07_RS00220 | 31677..32921 | - | 1245 | WP_015387351 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HPG07_RS00225 | 32934..33569 | - | 636 | WP_000934978 | A24 family peptidase | - |
| HPG07_RS00230 | 33573..34001 | - | 429 | WP_001326801 | lytic transglycosylase domain-containing protein | virB1 |
| HPG07_RS00235 | 34122..34679 | - | 558 | WP_000095051 | type 4 pilus major pilin | - |
| HPG07_RS00240 | 34724..35833 | - | 1110 | WP_000974900 | type II secretion system F family protein | - |
| HPG07_RS00245 | 35824..37362 | - | 1539 | WP_001420475 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HPG07_RS00250 | 37387..37881 | - | 495 | WP_000912551 | type IV pilus biogenesis protein PilP | - |
| HPG07_RS00255 | 37865..39187 | - | 1323 | WP_000454143 | type 4b pilus protein PilO2 | - |
| HPG07_RS00260 | 39226..40869 | - | 1644 | WP_001035590 | PilN family type IVB pilus formation outer membrane protein | - |
| HPG07_RS00265 | 40862..41380 | - | 519 | WP_015387353 | YfdA protein | virb4 |
| HPG07_RS00270 | 41427..43385 | - | 1959 | WP_000338974 | type IV secretory system conjugative DNA transfer family protein | - |
| HPG07_RS00275 | 43401..44456 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HPG07_RS00280 | 44475..45614 | - | 1140 | WP_015387354 | TrbI/VirB10 family protein | virB10 |
| HPG07_RS00285 | 45604..46305 | - | 702 | WP_053882504 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HPG07_RS00290 | 46371..47105 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HPG07_RS00295 | 47269..49626 | - | 2358 | WP_015387356 | VirB4 family type IV secretion system protein | virb4 |
| HPG07_RS00300 | 49632..49952 | - | 321 | WP_000362081 | VirB3 family type IV secretion system protein | virB3 |
| HPG07_RS00440 | 50023..50313 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HPG07_RS00310 | 50313..50897 | - | 585 | WP_001401693 | lytic transglycosylase domain-containing protein | virB1 |
| HPG07_RS00315 | 50918..51316 | - | 399 | WP_001708012 | hypothetical protein | - |
| HPG07_RS00320 | 51656..52093 | - | 438 | WP_015387358 | type IV pilus biogenesis protein PilM | - |
| HPG07_RS00325 | 52099..53334 | - | 1236 | WP_001419735 | TcpQ domain-containing protein | - |
| HPG07_RS00330 | 53337..53636 | - | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HPG07_RS00335 | 53703..54335 | - | 633 | WP_001419736 | hypothetical protein | - |
| HPG07_RS00340 | 54383..55192 | + | 810 | WP_001419737 | DUF5710 domain-containing protein | - |
| HPG07_RS00345 | 55239..55475 | - | 237 | WP_000750964 | EexN family lipoprotein | - |
| HPG07_RS00350 | 55479..56126 | - | 648 | WP_001419738 | type IV secretion system protein | - |
| HPG07_RS00355 | 56132..57118 | - | 987 | WP_001419739 | type IV secretion system protein | virB6 |
| HPG07_RS00360 | 57122..57379 | - | 258 | WP_000739144 | hypothetical protein | - |
| HPG07_RS00365 | 57376..57678 | - | 303 | WP_001360345 | hypothetical protein | - |
| HPG07_RS00370 | 57694..57945 | - | 252 | WP_015387362 | hypothetical protein | - |
| HPG07_RS00375 | 57942..58124 | - | 183 | WP_022540746 | hypothetical protein | - |
| HPG07_RS00380 | 58093..58755 | - | 663 | WP_001419740 | hypothetical protein | - |
| HPG07_RS00385 | 58766..58936 | - | 171 | WP_000550721 | hypothetical protein | - |
| HPG07_RS00390 | 58940..59383 | - | 444 | WP_000964840 | NfeD family protein | - |
| HPG07_RS00395 | 59456..60409 | - | 954 | WP_072105959 | SPFH domain-containing protein | - |
| HPG07_RS00400 | 60455..60649 | - | 195 | WP_000049865 | DUF1187 family protein | - |
| HPG07_RS00405 | 60642..61148 | - | 507 | WP_001358485 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3583 | GenBank | NZ_KX827311 |
| Plasmid name | p1083-CTXM | Incompatibility group | - |
| Plasmid size | 62196 bp | Coordinate of oriT [Strand] | 17699..17751 [-] |
| Host baterium | Shigella sonnei strain 1083 |
Cargo genes
| Drug resistance gene | blaCTX-M-55 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |