Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103135 |
| Name | oriT_pCA-26  |
| Organism | Citrobacter braakii strain CA-26 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KY624633 (15437..15489 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pCA-26
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2082 | GenBank | WP_000338974 |
| Name | t4cp2_HTL99_RS00240_pCA-26 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73347.89 Da Isoelectric Point: 9.1391
>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 34350..57031
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTL99_RS00175 | 29839..30963 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HTL99_RS00180 | 31012..31320 | + | 309 | WP_001199277 | hypothetical protein | - |
| HTL99_RS00185 | 31863..32018 | - | 156 | WP_001358489 | hypothetical protein | - |
| HTL99_RS00410 | 32094..32325 | + | 232 | Protein_39 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTL99_RS00190 | 32322..33698 | - | 1377 | WP_000750519 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTL99_RS00195 | 33711..34346 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HTL99_RS00200 | 34350..34832 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTL99_RS00205 | 34898..35455 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HTL99_RS00210 | 35500..36609 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTL99_RS00215 | 36600..38138 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTL99_RS00220 | 38163..38657 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTL99_RS00225 | 38641..39963 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTL99_RS00230 | 40002..41645 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTL99_RS00235 | 41638..42174 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HTL99_RS00240 | 42221..44179 | - | 1959 | WP_000338974 | type IV secretory system conjugative DNA transfer family protein | - |
| HTL99_RS00245 | 44195..45250 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTL99_RS00250 | 45293..46432 | - | 1140 | WP_000790641 | TrbI/VirB10 family protein | virB10 |
| HTL99_RS00255 | 46422..47123 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTL99_RS00260 | 47189..47923 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTL99_RS00265 | 48089..50446 | - | 2358 | WP_104652138 | VirB4 family type IV secretion system protein | virb4 |
| HTL99_RS00270 | 50452..50772 | - | 321 | WP_000362081 | VirB3 family type IV secretion system protein | virB3 |
| HTL99_RS00405 | 50843..51133 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTL99_RS00280 | 51133..51717 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HTL99_RS00285 | 51738..52136 | - | 399 | WP_053899065 | hypothetical protein | - |
| HTL99_RS00290 | 52255..52692 | - | 438 | WP_053899063 | type IV pilus biogenesis protein PilM | - |
| HTL99_RS00295 | 52698..53933 | - | 1236 | WP_053899060 | toxin co-regulated pilus biosynthesis Q family protein | - |
| HTL99_RS00300 | 53936..54235 | - | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTL99_RS00305 | 54283..55074 | + | 792 | WP_022645137 | DUF5710 domain-containing protein | - |
| HTL99_RS00310 | 55152..55388 | - | 237 | WP_000750964 | EexN family lipoprotein | - |
| HTL99_RS00315 | 55392..56039 | - | 648 | WP_022645138 | type IV secretion system protein | - |
| HTL99_RS00320 | 56045..57031 | - | 987 | WP_053899058 | type IV secretion system protein | virB6 |
| HTL99_RS00325 | 57035..57292 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTL99_RS00330 | 57289..57591 | - | 303 | WP_001360345 | hypothetical protein | - |
| HTL99_RS00335 | 57607..57873 | - | 267 | WP_228299791 | hypothetical protein | - |
| HTL99_RS00340 | 58094..58747 | - | 654 | WP_053899054 | hypothetical protein | - |
| HTL99_RS00345 | 58758..58928 | - | 171 | WP_000550721 | hypothetical protein | - |
| HTL99_RS00350 | 58932..59375 | - | 444 | WP_000964333 | NfeD family protein | - |
| HTL99_RS00355 | 59378..59632 | - | 255 | WP_024181945 | hypothetical protein | - |
| HTL99_RS00360 | 59761..60714 | - | 954 | WP_072097371 | SPFH domain-containing protein | - |
| HTL99_RS00365 | 60741..60917 | - | 177 | WP_000753050 | hypothetical protein | - |
| HTL99_RS00370 | 60910..61125 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HTL99_RS00375 | 61118..61624 | - | 507 | WP_039022938 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3578 | GenBank | NZ_KY624633 |
| Plasmid name | pCA-26 | Incompatibility group | IncI2 |
| Plasmid size | 62214 bp | Coordinate of oriT [Strand] | 15437..15489 [-] |
| Host baterium | Citrobacter braakii strain CA-26 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |